KEGG   Mus musculus (mouse): 329540
Entry
329540            CDS       T01002                                 

Symbol
Nol4l, 4931410H15, 8430427H17Rik, AI429157, Gm1636
Name
(RefSeq) nucleolar protein 4-like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF5569
Other DBs
NCBI-GeneID: 329540
NCBI-ProteinID: NP_001001986
MGI: 1918765
Ensembl: ENSMUSG00000061411
Vega: OTTMUSG00000016765
UniProt: Q3TZG8 Q52KQ8
Position
2; 2 H1
AA seq 435 aa
MNDSAWMSADPHLASSLSPSQEERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSST
QGDPAFPEMNGNGAAAPMDFTATAEDQPINLCEKLPPGTALGTPSYPSDGCGTDGLRSRV
KYGVKNTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPAADDDDDDHDDHEDNDKMNDSE
GMDPERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRT
YLKSCRRMKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQEEPI
ALDKQHSRDSTAITHSTYSLPASAYSQDPVYVNGGLNYSYRGYGSLSSNLQPSASLQTGN
HSNGPTDLSMKGGASTPTPPTPTPSSNSTSRTMPTAQLSPTEISAVRQLIAGYRESAAFL
LRSADELENLILQQN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaatgactccgcatggatgtcagctgacccccacctggcctccagccttagccccagc
caagaggagaggatgcggagcccacagaacctccatagccaggaggatgatgactcctcc
tctgagagcggcagcggcaatggctcttctaccctgaacccatccacttcaagcagcaca
cagggggaccccgccttccctgagatgaatggcaacggagctgcagcccccatggacttc
accgccactgccgaggaccagcccattaacctgtgtgagaagctcccgcccggcacagct
ctgggcacgccgtcctacccctcagacggctgcggcactgatgggctgcggagccgcgtc
aagtatggggtaaagaacacccccgagtcacccccatacagctccgggagctatgattcc
atcaagactgaagtcagtggctgtcctgaggacctgacagtgggccgggcccctgcagca
gatgacgatgacgatgaccatgatgaccatgaggacaatgacaagatgaatgactcagag
ggcatggaccccgagcggctcaaggccttcaacatgttcgtgcggctcttcgtggatgag
aacctggaccgcatggtgcccatttccaagcagcccaaggagaagatccaggccatcatc
gagtcctgcagccggcaattccctgagttccaggagcgggcccgcaagcgcatccgcaca
tacctcaagtcctgccgccgcatgaagaagaacggcatggagatgaccagacctactcct
ccgcatctgacctcagccatggcagagaacatcctagcagctgcctgtgagagtgagacg
agaaaggcagccaagaggatgcgcctggagatctaccagtcctcacaagaagaacccata
gccctggataagcagcactctcgggactctacagccatcacccactccacctactcactg
ccagcctctgcctactcccaggaccccgtgtatgtcaacggtggcctcaattacagctac
cgtggctatgggtccttgagcagcaacttgcagccctctgcttccctccagacaggaaat
cacagtaatgggcccacagacctcagcatgaaaggcggggcctctaccccaactcctccc
acgcctaccccttccagcaacagcaccagcaggaccatgcccacagcccagcttagcccc
acggagatcagtgctgtgcggcagctcatcgcaggctatcgagagtctgcagccttcctg
ctgcgttctgcagatgaactggaaaacctcattttacagcagaactga

DBGET integrated database retrieval system