KEGG   Mus musculus (house mouse): 329716
Entry
329716            CDS       T01002                                 
Symbol
D730018G16
Name
(RefSeq) cDNA sequence BC107364
Organism
mmu  Mus musculus (house mouse)
SSDB
Other DBs
NCBI-GeneID: 329716
NCBI-ProteinID: NP_001243109
MGI: 3618860
Ensembl: ENSMUSG00000046317
UniProt: E9Q5A2
Position
3:complement(96341104..96361676)
AA seq 140 aa
MLRRFVLAAKPRLGGVRLQNRSRGKEKFNPEFELLACLNRKPDNQTDCPNHLKSASLTQT
KTGPHRSELQCPKANSRGRQRYKKLWIRFCQHVYIPWCPRKPEEGIRSPETGVIDWSLWF
CHHDTSGSVSLMDFSTCCGS
NT seq 423 nt   +upstreamnt  +downstreamnt
atgctgagaaggtttgtgctggcagctaagcccaggcttggtggtgtgagacttcaaaac
aggagccgaggaaaggagaaattcaacccagaatttgagttactcgcctgtctaaacaga
aaaccggacaaccagaccgactgccccaaccacctgaaatccgcgtccttgacccaaaca
aagacaggacctcacagaagcgaactgcagtgtcccaaagcgaacagcagagggagacag
aggtacaagaagctctggatcaggttttgccagcacgtctatattccctggtgccctagg
aagccagaagagggcatcagatcccctgagactggagttatagactggagcctctggttc
tgccaccatgacacgtcgggttctgtttcactgatggatttttctacttgttgtggatca
tga

DBGET integrated database retrieval system