KEGG   Mus musculus (house mouse): 329739
Entry
329739            CDS       T01002                                 
Symbol
Fam102b, 1600010D10Rik, B430201A12Rik
Name
(RefSeq) family with sequence similarity 102, member B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NT-C2
Other DBs
NCBI-GeneID: 329739
NCBI-ProteinID: NP_001157039
MGI: 3036259
Ensembl: ENSMUSG00000040339
UniProt: Q8BQS4 E9Q4R1
Position
3:complement(108878313..108935588)
AA seq 370 aa
MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVHWRKKF
SFMCKMSASASTGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLE
GYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLEEDRKGGETLKV
HLGIADLSAKSASVPDELGAWGHSRTSSYASQQSKVSGYSTCHSRSSSFSEFCHRRNTSV
GSTSTGIESILEPCDETEPITAEPSPDPTAAAATATTTTAKEEEASEKLARCPVKQDSVE
SQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGS
GAYEQVVIKR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgatgaagaagaagaagtttaagtttaaggtggacttcgagctcgaggagctctcctcg
gtgcccttcgtcaacggggtcctcttctgcaagatgcggctgctggacggcggcagcttc
accgccgagtcctccagggaggtggtgcaagcaaattgtgttcactggagaaagaagttc
tcgtttatgtgcaaaatgagcgccagcgcctccaccggcatcctggatccttgtatctac
agagtgtctgtacggaaggaattaaaaggtgggaaagcgtatgcaaagctgggctttgca
gatctaaacctggcagagtttgctggatcaggaaataccacccgccgctgtttactggaa
ggctatgataccaaaaatacaagacaggacaattccatccttaaagttttgatcagtatg
cagctgatgtctggtgacccgtgttttaaaacgcctccttccacatccatgtcaatacca
atcgctggggaatctgagtctctggaagaggacaggaaaggtggcgagaccctcaaagta
catcttggaatagcagatctttcagcaaagagtgcctctgttccagatgaacttggtgcc
tggggacactctagaacatcaagctatgcaagccagcagtccaaagtatcaggctatagc
acatgtcactcccggtcatccagtttctccgagttctgccacaggagaaatacctcagtg
ggaagcacgtcaacggggattgaaagcattctcgagccatgtgacgagactgagccaatc
acagctgaaccaagtccagaccccaccgctgctgccgccaccgccaccaccaccaccgct
aaggaagaggaagcttccgagaaactcgccagatgtccagtgaagcaagattctgttgag
tcgcagctgaagcgggttgatgacaccagagtggatgctgatgacatcgtggagaaaatc
ctacagagtcaggacttcagcctcgactccagtgcagaagaagaagggctgaggttgttc
gtgggacctgggggaagtacaacctttggcagccaccaccttccaaacagggtaggatct
ggagcctatgaacaggttgtgatcaaacgctag

DBGET integrated database retrieval system