KEGG   Mus musculus (house mouse): 329877
Entry
329877            CDS       T01002                                 
Symbol
Dennd4c, 1700065A05Rik, AA420392
Name
(RefSeq) DENN/MADD domain containing 4C
  KO
K20163  DENN domain-containing protein 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    329877 (Dennd4c)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    329877 (Dennd4c)
SSDB
Motif
Pfam: DENN uDENN dDENN PPR_3 PPR_long CoV_NSP10
Other DBs
NCBI-GeneID: 329877
NCBI-ProteinID: NP_908976
MGI: 1914769
Ensembl: ENSMUSG00000038024
UniProt: A6H8H2
Position
4:86666761..86768840
AA seq 1906 aa
MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRTDTNSIGPKAPITDIAVIIKSAGETVPEG
YTCVEATPSALQANLNYGSLKSPELFLCYRRGRDKPPLTDIGVLYEGKERLMPGCEVIQA
TPYGRCANVNNSSTTSQRIFITYRRAPPVRSQNSLAVTDICVIITSKGETPPHTFCKVDK
NLNCGMWGSNVFLCYKKSVPASNAIAYKAGLIFRYPEEDYESFPLSPSVPLFCLPMGATI
ECWDPQIKYPLPVFSTFVLTGSSAEKVYGAAIQFYEPYSQERLTEKQLTQLGLLTLVEKR
VVSKPINSNKCICLLSHWPFFEAFKNFLMFIYKVSVSGPHPLPIEKHISHFMQNIPFPSP
QRPRILIQLSVHDAFILSQPVSTPLPLSGANFSSLLMNLGPENCATLLLLVLLESKILLH
SLRPAVLTGVAEAVVAMIFPFQWQCPYIPLCPLSLAGVLSAPLPFIVGVDSRYFDLHDPP
QDVVCIDLDTNTLYVADERKNINWKQLPKRPCKSLLGTLRRLYQQLCSVHRKPQESSAIE
MTPIEADYSWQKKMTQLEMEIQETFLRFMASILKGYRSYLRPITEAPSNKATAADSLFDR
QGFLKSRDRAYTKFYTLLSKTQIFIRFIEECSFVSDKDTGLAFFDDCIEKLFPDKGVERT
EKVDLDSAEDTRLIELDDSQRSEHTVFIMPPEPPPDDGNNLSPQYSYTYFPRLDLKLFDS
PQKLKLCFNRHPPGSSITNSPALMAKRTKQEIKTAHKLAKRCYTNPPQWAKYLFSHCYSL
WFICLPAYVRVSHPKVRALQQAHDVLVKMRKTDVDPLDEVCYRVVMQLCGLWVNPVLAVR
VLFEMKTARIKPNAITYGYYNKVVLESPWPSSTRSGIFLWTKVRNVVHGLAQFRQPLKKT
GQKSQVFSISGGQSDQGYGSKDELVKEGADGHAPEEHTPPELTTTELHIEEECDISAIVS
KHLQPTPEPQSPTEPPAWGSSIVKVPSGLFDTNNRTSTGSTSTVLFSTQAPVEDAVFSEV
TNFKKNGDRGEKKQKHFPERSCSFSSESRAGMLLKKSSLDLNSSEMAIMMGADAKILTAA
LTCPKTSPPHVTRTHSFENVNCHLADSRTRMSEGTRDSEHRSSPVLEMLEESQELLEPVV
GDNVAETAAEMTCNSLQSNSHSDQSRDTQAGAQDPVNKRSSSYATRKAIEREDVETGLDP
LSLLATECVEKTSDSEDKLFSPVISRNLADEIESYMNLKSPLGSKSCSMELHGEGNQEPG
SPAVFAHPLERSSSLPSDRGPPARDSTETEKSSPAVSSSKTLTGRFKPQSPYRAYKDRST
SLSALVRSSPNSSLGSVVNSLSGLKLDNILSGPKIDVLKSSMKQAATVASKMWVAVASAY
SYSDDEEETNKDYSFPAGLEDHHIVGETLSPNTSVSGLVPSELTQSNTSLGSSSSSGDVG
KLQCPAGEVPFSRNIKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVY
DEEIMAGWTADDSNLNTTCPFCKSNFLPLLNVEFKDLRGSASFFLKPSTSGDSLQSGSIP
SASEPSEHKPTSSSAEPDLISFMDFSKHSETITEEASYTVESSDEIKKTNGDVQSVKMSS
VPNSLSKRNVSLTRSHSVGGPLQNIDFSQRPFHGVSTVSLPSSLQEDVDHLGKRPSPPPV
SVPYLSPLVLRKELESLLENEGDQVIHTSSFINQHPIIFWNLVWYFRRLDLPSNLPGLIL
TSEHCNGGVQLPLSSLSQDSKLVYIQLLWDNINLHQEPGEPLYVSWRNLNSEKKPSLLSE
QQQAASALVETIRQSIQQNDVLKPINLLSQQMKPGTKRQRSLYREILFLSLVSLGRENID
IEAFDNEYGLAYRSLPSESLERLQRIDAPPSISVEWCRKCFGAPLI
NT seq 5721 nt   +upstreamnt  +downstreamnt
atgatagaagacaaaggacctagagtgacagactacttcgttgtggcaggtctcactgat
acatccactcttttggatcaagaaataaatcgtacagatactaactcgattggtcctaaa
gctccaatcacagacattgctgttattatcaaatcagctggggaaactgtacctgaaggc
tacacctgtgtggaagccactccatcagcactccaagcaaacttgaattatggaagtctg
aagagcccagagcttttcctgtgctacaggagagggagagataagccgccccttacagat
attggcgtgctatatgaagggaaagaaaggcttatgccaggatgtgaagtgatccaagcc
acgccgtacggccgctgtgccaatgtcaacaatagttcaactacttctcaaagaatcttt
atcacctatcgaagggctcccccagtgcggtcccagaattccttggccgtcactgatatc
tgtgttattataaccagtaaaggagaaacccctccgcatactttctgcaaagtggataaa
aatttaaactgtggcatgtggggttccaacgtgtttctgtgttacaagaagtctgtgcct
gcttcaaatgcaatagcatataaggctggtttgatttttcgatatccggaagaagactat
gagtcttttccgctctcaccatctgtgcctctcttctgccttcctatgggagccactatt
gaatgctgggatcctcaaatcaaatacccacttcctgttttctcaacatttgtcctgaca
gggtcttcagctgaaaaggtatatggagctgccatccagttttatgaaccttactctcaa
gaacgtctaacagagaaacaacttacacagctgggcctattgaccctcgtggagaaaaga
gtggtctccaaacccatcaattcaaacaagtgcatttgtttgctttcacactggcctttt
tttgaagcttttaagaattttcttatgtttatctacaaagtttctgtgtctggaccacat
cctcttcccattgaaaagcacatttcacattttatgcaaaatatcccttttccttcacca
caaagaccaagaatcctcatccagctatcagtccatgatgcatttatattatcacagcca
gtgtccacacctttaccattaagtggcgccaactttagctccttgctgatgaatctgggt
cctgagaactgcgcgacattgctgctgctggttttgctcgagagtaagattctgctgcac
tctctgaggccagcggtactaactggggtagccgaagctgtcgttgctatgatctttcca
tttcagtggcagtgcccatatatccccctctgtcctctttcattggctggagtgcttagt
gcgcctttaccatttatagttggagtggactcaaggtactttgatcttcatgacccacca
caagatgttgtctgcattgacttggatacgaacacattatatgtagctgatgaaagaaag
aacataaactggaagcagcttcccaaaaggccgtgcaagagtctgcttggcaccctgagg
aggctgtatcagcagctctgctcagttcaccgaaaacctcaagaaagttcagcaattgag
atgactccaattgaagcagattactcttggcaaaaaaagatgacacaattggagatggaa
attcaggagacatttttgcgatttatggcgtctattttaaaagggtacaggtcatatctc
agaccaatcacagaagctccttctaataaagccacagctgcggattcattgtttgatcga
cagggttttttgaaaagtcgggatcgtgcctatacaaaattctatactcttttatccaaa
acacagatttttattcgtttcattgaagaatgcagttttgtaagtgataaagatactgga
ttggcattttttgatgattgcatcgagaagttgtttccagataaaggtgtagagagaaca
gaaaaggttgacttggattcagcagaagacaccagattgatagagctagatgattcacag
agaagtgaacacactgtatttataatgccacctgagccgcctcctgatgatggaaataac
ttatcacctcagtacagttacacatactttccaagattggatcttaagctttttgacagc
ccacagaagctgaaactgtgcttcaatagacatcctcctgggagtagcattacaaacagc
cctgccctcatggctaaaaggactaaacaggagataaaaacagctcataagttggcgaag
agatgttatacgaatccaccacaatgggccaagtatctattcagccactgttacagtctg
tggtttatttgtctcccagcctatgttagagtttctcaccctaaggtccgagcactccag
caggcacatgatgtgcttgttaagatgcggaagacagacgtggatccactagatgaggtg
tgctatcgagtagtcatgcagctttgtggactttgggttaatcctgttttagcagtgaga
gtcttattcgagatgaaaactgctagaataaaaccaaatgctatcacttatggctattac
aataaggtagttttggagagcccatggcccagcagtactcgcagtggtattttcttgtgg
acgaaagtacggaatgttgtacatggtttggcccagtttaggcaaccacttaaaaagact
gggcaaaaatcacaggtcttttcaatatcaggcggtcagtctgaccagggctacgggtct
aaggatgagctggtaaaggagggtgcagatggtcacgcccctgaagagcacacgccacca
gagctgacgaccacagagctgcacatcgaagaggagtgtgatatatctgccattgtctca
aaacacctgcagcctactcctgaacctcagagtcctacggagcctcctgcatggggcagc
agtattgtgaaagttccatctgggttatttgataccaacaataggacaagtactggtagt
acttcaactgtgctattttctactcaagctccagtcgaggatgcagtcttcagtgaggtt
actaatttcaagaagaatggtgatagaggagagaaaaaacagaagcatttccctgagagg
agctgtagctttagttctgaaagtcgagcggggatgctgcttaagaagagcagtttggac
ctgaattcaagcgaaatggccatcatgatgggagcagatgccaagatcctcacagcagca
ctgacatgtcctaagacttccccgcctcatgtcacaagaactcacagctttgagaatgtt
aactgtcatctagctgacagtaggactcgcatgtcagaaggcacccgggattctgagcac
agatcatctcctgtgctagagatgctggaggaaagccaggagctcctggagcctgtggtt
ggtgataatgtggcagagactgcggcagagatgacgtgtaacagtctacaaagtaacagt
cacagtgaccagtccagagacacacaagctggagcccaagatccagtgaacaagaggagc
agttcatatgctactaggaaagccattgagagggaggatgtggagacgggactagatccg
ttgtctcttttagccactgaatgtgtagaaaaaacgtctgattctgaagataagttattt
tctccagtaatttcacgtaatctggctgatgaaattgaaagttacatgaacctaaaaagc
ccactaggcagtaaatcttgtagtatggaattgcatggagaggggaaccaggagcctggc
tctcctgctgtgtttgctcaccctttagaaaggagctcgagtctgccttcagaccgtggc
ccgccagcacgagacagcaccgagactgagaagagctcccctgctgtgtccagctctaaa
actctgactgggcgtttcaagccacagagtccttaccgcgcttacaaagaccggtccact
tccttatcagcattagtacgttcttcaccaaacagctctctgggttctgtagtcaattct
ctatcggggctaaagttggacaatatactctcagggcccaagatagatgtcctaaaatct
agtatgaaacaagcagcaacggtggccagtaagatgtgggtggctgtagcatctgcctat
agctactcagatgacgaggaggaaactaataaagattacagtttcccagctggcctagaa
gaccatcatatagtgggagagactctgtcgcctaacacaagtgtctcagggttggttccc
agtgaactgacccagagcaacacaagcctcggcagtagtagcagcagtggagacgttgga
aaactgcagtgtccagcaggtgaagttccattttcaagaaatatcaaagggcaggacttt
gaaaagtcagaccatggttcttctcagaataccagtatgtctagcatctatcaaaattgt
gcgatggaggttttgatgtcgagttgctcacagtgcagagcttgtggcgctctggtttat
gatgaggaaatcatggctggatggacagcagatgactcaaatttgaatacaacctgcccg
ttctgtaaaagcaacttcttgcctcttctcaatgtagaatttaaagacctgcgaggctct
gccagctttttcttgaaaccaagcacgtctggtgacagtttacaaagcggcagcattcca
tcagccagtgagccctctgaacacaaacccacgtccagttcagcagaacctgacctgatc
agctttatggatttctcaaaacacagtgagaccataacagaagaagcaagttatacagtc
gaatcaagtgatgaaataaagaaaaccaatggtgatgtccagagtgtgaaaatgtcatct
gtgcctaacagtttatctaagcgaaacgtatctttgactcgaagtcacagtgttggaggc
cctctgcagaatatcgacttctcccagcgaccatttcatggcgtctcaacagtcagtctt
ccaagcagtctgcaggaagatgtggaccatctaggcaagcgacccagtcctcctcctgtg
tctgtgccctatttgagtcctctagtgcttcggaaggaacttgaatctttgctagaaaat
gaaggtgatcaggtcatccatacatcctcattcatcaatcaacacccaatcattttctgg
aacctggtttggtatttcagacgtttggaccttcctagcaacttgccaggccttattctc
acctctgagcattgtaatggaggtgtgcagcttcctctatcatctttgtcccaggacagc
aaactggtgtatattcaactgctgtgggataatatcaaccttcatcaggaaccaggagaa
cctctgtatgtctcttggaggaacttgaattctgagaagaagccgtcacttctgtcagag
cagcagcaggcagccagcgctttagtggagacgatcaggcagagcatccagcagaatgac
gttctcaagcccatcaacctgctttcccagcaaatgaagccaggcacgaaacggcagagg
agtttatacagagaaatccttttcttatcattagtgtctcttgggagagaaaacattgat
attgaggcttttgacaatgaatatggactcgcatacagaagtctgccttcagagagtctt
gaaaggttacagagaatcgatgccccacccagtatcagtgtggagtggtgcaggaagtgt
tttggagcgcctctcatttaa

DBGET integrated database retrieval system