KEGG   Mus musculus (mouse): 329941
Entry
329941            CDS       T01002                                 

Gene name
Col8a2, AI429819
Definition
(RefSeq) collagen, type VIII, alpha 2
  KO
K23455  collagen type VIII alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    329941 (Col8a2)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 329941
NCBI-ProteinID: NP_955767
MGI: 88464
Ensembl: ENSMUSG00000056174
Vega: OTTMUSG00000009356
UniProt: P25318
Position
4 D2.2; 4 60.29 cM
AA seq 699 aa
MQGALMPLPSLLLLLLGCGPRVSSGGGAGGAAGYAPVKYVQPMQKGPVGPPFREGKGQYL
EMPLPMLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGTGKPGVHGQPGPAGPPGFSRMGK
AGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITVPGKPGAQGAPGPP
GFRGEPGPQGEPGPRGDRGLKGDNGVGQPGLPGAPGQAGAPGPPGLPGPAGLGKPGLDGI
PGAPGDKGDSGPPGVPGSRGEPGAVGPKGPPGVDGVGIPGAAGVPGPQGPVGAKGEPGLR
GPPGLIGPVGYGMPGKPGPKGDRGPVGAPGLLGDRGEPGEDGKPGEQGPQGLGGPPGLPG
SAGLPGRRGPPGSKGEVGPGGPPGVPGIRGDQGPNGLAGKPGLPGERGLPGAHGPPGPTG
PKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLPGLKG
EPGLPGPPGEGKVGEPGSAGPTGPPGVPGSPGLTGPPGPPGPPGPPGAPGALDETGIAGL
HLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVRFDRTLYNGHSG
YNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAV
LQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgcagggggctctgatgcccctgccttcgctgctgctgttgctgttggggtgtgggcca
agagtgtcctctggcggcggagctgggggtgcagcgggctatgccccggtaaagtatgtg
cagcccatgcagaaaggacccgtgggaccgcctttccgagagggcaaaggccagtacttg
gaaatgcctctaccgatgctgccaatggacttgaaaggagagccaggtccccctgggaag
ccgggacctcggggtccccctgggcctcctggcttcccaggaaaaccaggcactggaaaa
cctggggttcatggacagccaggccctgctggcccccctggcttctcccgaatgggcaaa
gctggtcccccagggctcccaggcaaggttggaccaccagggcagccagggctacggggg
gagccagggatacgaggggaccagggcctccgggggcccccaggaccccctggccttcct
ggtccctcaggtattactgtccctggaaaaccaggtgcccagggggctccagggcctcca
ggatttaggggggagccaggaccccagggagagcctgggccccgaggagataggggcctc
aaaggggataatggagtgggccaaccagggctgcctggagcccctggacaggcaggtgcc
cctgggccccctgggctgcccggtccagctggcttgggcaaaccaggtttggatgggata
ccaggagccccaggagacaaaggtgattctggcccccctggggttccaggttctagggga
gagccaggagctgtgggtccaaaaggccctcctggggtagatggtgtggggataccaggg
gcagcaggggtgccagggccacagggtccagtaggggctaaaggagagccagggctccgg
ggcccccctggcctgataggccctgttggctatgggatgccaggaaaaccaggacctaag
ggagacaggggcccagttggggccccagggctcttaggagacagaggtgagccaggagag
gatgggaagccaggggagcagggtccacagggacttgggggtccacctggccttcctggg
tctgcagggcttcctggtagacgtgggccccctgggtcaaagggagaggtaggacctgga
ggtcccccaggagtgcctggcattcgaggagaccaagggcctaatggcctggctgggaag
cctgggctccctggtgagaggggacttcctggggcccatggaccccctggaccgactggg
cctaagggtgagccaggttttacaggtcgccctggagggccaggggtggcaggagcccta
ggacagaaaggtgacttggggcttcctgggcagcctggcttgaggggtccctctggaatc
ccagggctccagggcccagctggccctattgggcctcagggtctgccaggcctgaagggt
gaaccgggccttccagggcctcctggagagggaaaagtaggggagcctggctctgctggt
cccacagggccccctggagtccctggctccccaggactcacaggtcctcctgggccccct
gggcctcctgggcctcctggtgcccccggagccctggatgagactggtatcgcaggcttg
catctgcccaatggtggcgtggagggagctgtactgggcaaaggaggcaagccacagttt
gggctcggtgagctgtcagcccacgccactccagcctttactgcagtgctcacttccccc
ttccctgcctcaggcatgccggttaggtttgaccggactctctacaatggccacagcggc
tacaacccagccactggcatcttcacctgccccgtgggaggggtctactactttgcatac
catgtgcatgtcaagggcaccaatgtgtgggtagccctgtacaagaacaatgtgccggcc
acctacacgtacgacgaatacaagaagggctacctggaccaggcttcgggaggggctgtg
ctccagctgcggcccaatgaccaggtgtgggtgcagatgccctcagatcaggccaatggt
ctctactccaccgagtacatccattcgtccttctcaggattcttgctctgtcccacataa

DBGET integrated database retrieval system