KEGG   Mus musculus (house mouse): 329977
Entry
329977            CDS       T01002                                 
Symbol
Fhad1, 2900090M10Rik, B230311F11
Name
(RefSeq) forkhead-associated (FHA) phosphopeptide binding domain 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 329977
NCBI-ProteinID: NP_808536
MGI: 1920323
Ensembl: ENSMUSG00000051435
Vega: OTTMUSG00000010111
UniProt: A6PWD2
Position
4:complement(141617741..141742438)
AA seq 1420 aa
MKAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFNEAEGTFVLQDFNSRN
GTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCPWVRGPAPWPSPQPHLS
SSPPDMPFHHGIQPATVQRSWSQGCPRPTMVPPAPHQRPMSASGKMFSFVMDPKSPVINQ
VWANAMDMSEQCMMDGLSGTIPPTEIFMDHDLSQQDKDEIILLLGREVNRLSDFEMESKY
KDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGVDEGDDLRQKEIESMKSQIN
ALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSGMVTSLQKDMSARNEQVQQLQ
EEVNRLRIENREKEYQLEALSSRCSVMKEELRKEEAQKDRREAQEKELKLCRSQMQDMEK
EVRKLREELKKNYMGQNIISKTLREKNKVEEKLQEDSRRKLLQLQEMGNRENLIKINLER
AVGQLENFRNQVIKATFGKTKPFRDKPITDQQLIEKIIQVTEDNLSFQQRKWTLQRETHL
HPKQEETMHSVEKLRVLLDKCQACMRDSCSSIDLKKEVELLQHLPLSPLVSGLQKTVVNI
LRVSLSWLEETEQLLGDLDIELSDSDKGFSLCLIYLLEHYKKIMSQSQDLQAQMNASRET
QKSLRQEHLAEKEKLAEKLEQEEKLKAKIQQLTEEKAALEESIGQEKSRSEEALEKAQAR
VRELENHLASQKEALENSVAQEKRKMREMLEAERRKAQDLENQLTQQKEISENNTYEKLK
MRDTLEKEKRKIQDLENRLTKQKEEIELKEQKENVLNNKLKDALVMVEDAQQMKTTESQR
AETLALKLKETLAELETTKTKMILTDDRLKLQQQSMKALQDERESQKHGFEEEISEYKEQ
IKQHSQTIVSLEERLCQVTQYYQKIEGEITTLKNNDTGPKEEASQDLTAGPPLDSGDKEI
ACDHLIDDLLMAQKEILSQQEIIMKLRTDLGEAHSRMSDLRGELSEKQKMELERQVALVR
QQSGELSMLKAKVAQTTGLMEKKDRELKVLREALRASQEKPRPHLSTEQKPRTLSQKCDI
SLQIEPAHPDSFSSFQEEQSFSDLGVKCKGSRHEETIQRQRKALSELRTRVRELEKANSC
NHKDHVNESFLELRTLRMEKNVQKILLDAKPDLTTLARVEIRPPQNSPFNSGSTLVMEKS
VKTDAGEALELSEKLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLV
FDKITQLKTRLQRKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLK
EALERTEQQLSQERRFNRVFKQQKDRGEDPEQRNMSYSPFKDNEKQRRLFVEMVKSKMQN
SSVQAGAKKATLKTGQERETKKEAYKSTQSLSFVKPGGKN
NT seq 4263 nt   +upstreamnt  +downstreamnt
atgaaagcgtatttgaagagcgctgatggcttttttgtcctgaataaaagcaccacaatc
ggcaagcatgcagattcagacctcgtcttacagtccgcagatatcgacaaccaccatgcc
ctcattgaattcaacgaggccgagggcaccttcgtccttcaggactttaactcccgcaac
ggcacgtttgtcaacgagtgccacattcagaatgtggcggtgaagctgatccctggggac
attctgcggttcgggtctgcagggatgacctacgagctggtcattgagaacccgtccccg
gtctcctgcccatgggtgaggggcccagcaccttggccaagtccacagccacacctgtcg
tcctcgccacccgacatgcccttccaccacggtatccagccagcaacagtgcagagaagt
tggtcacagggttgtcccagacccaccatggtcccacctgcccctcaccagcggcccatg
agtgccagcgggaagatgttttcctttgtgatggacccaaagtcccctgtcatcaaccaa
gtgtgggccaacgctatggacatgtcagagcaatgcatgatggatggactctccgggacg
atacctcccaccgagatcttcatggaccacgacctaagccagcaagacaaggacgagatc
attctgctcttggggagagaggttaatcggctctctgactttgaaatggagtccaaatat
aaagacgctctgatcatgaacctgcaggctgaggtggccgacctgagccaaaggttgtca
gagacagccgctgtcgccgcagccaggcagagtaacaggtgtgacccgaagctccagggc
gtggatgaaggcgacgatctcaggcagaaggagattgagagcatgaaaagccagatcaac
gctcttcaaaaaggctatagccaggtgctgagtcagaccctggcagagcgcaacacggaa
atcgaatccctgaagaatgagggcgagaacttaaagagagaccatgccattacatcaggg
atggtgacatctttacagaaagacatgtcagcacgcaacgagcaagttcaacagctgcag
gaggaggtaaatcgactgaggatcgagaacagggagaaggagtaccagctggaagccctg
agctccaggtgttcagtgatgaaagaagagctaagaaaggaagaggctcagaaggatcgc
agggaggcccaggagaaagagctgaagctatgcagaagtcaaatgcaagacatggagaaa
gaagtgaggaagctcagagaggaactaaagaagaactatatgggtcagaacatcatctcc
aagacgctacgagaaaagaacaaggtcgaagagaagcttcaggaagattccagaaggaaa
ttgcttcagctgcaagaaatggggaacagagagaacctcattaaaatcaatttggaaagg
gcagtaggccagctagagaacttcagaaaccaggtcatcaaagccactttcggaaaaaca
aagccattccgcgacaagcccatcacggaccagcagctgatagagaagatcatccaggtc
accgaggacaacctcagcttccagcagaggaagtggaccctgcaaagggagacccatctg
caccccaagcaagaggagaccatgcacagcgtggagaagctgagggtgctgctggacaag
tgccaggcttgcatgagggattcctgcagcagcatcgacctgaagaaggaggtggagctc
cttcagcacctgccgctcagcccgctcgtgtcaggacttcagaagacggtagtgaacatc
ctgagggtgtccctgtcctggctggaggaaacagagcagctgctcggggacctcgacatc
gagctctcggattctgacaaagggttctctctgtgtctgatatatcttctggaacattac
aagaaaattatgagccagtcccaggatcttcaggcccagatgaacgcctctcgggaaaca
cagaagtctctgcggcaggagcacctggctgagaaagagaagctggcagagaagctggag
caagaagagaagctgaaagccaaaatccagcagctgacagaagagaaggcagctctggaa
gagagcatcggtcaggagaaaagcagatcggaggaggccctggagaaggcgcaagcccga
gtccgtgagctggagaaccacttggctagtcaaaaggaggccttggagaacagtgtggct
caagagaaaagaaaaatgcgggaaatgctggaggcagaaaggaggaaggcacaagacctg
gagaatcagctgacccagcagaaggagatctcagagaacaacacgtatgagaaactcaag
atgagagacactctagagaaggagaagaggaaaatacaggacctggagaatcgcctgact
aagcaaaaagaggagatagaattaaaggagcagaaagaaaacgtcttaaataataaatta
aaagacgccctggtcatggtagaggacgctcagcagatgaagacaacggagagtcaaaga
gccgagacgctcgctctgaagttaaaggaaacattagcagagctagaaacaaccaagacg
aaaatgatcctgacggacgatcggctgaagctgcagcagcagtcgatgaaggccctgcag
gatgagcgggaatcccagaagcacggcttcgaggaggaaatctcagagtacaaagagcag
atcaaacagcactcgcagaccatcgtgagcctagaggaaaggctctgccaagtgactcag
tactaccagaagatagaaggggagatcacaacgttgaaaaacaacgatacaggaccgaag
gaggaagcctcccaagaccttacagcaggaccccccctggacagtggtgacaaagaaata
gcgtgcgaccatctgatagatgacttactaatggctcagaaggaaatcctatcccagcag
gagataatcatgaagctgaggactgacctcggggaagctcacagccggatgtcagacctg
agaggggaactaagcgagaagcagaagatggagctggagcggcaggtggccctggtgcga
cagcagagcggggagctgagcatgctgaaggcgaaggtggcgcagacgactggcctgatg
gagaagaaggacagggaactgaaggtcctcagggaggcgctcagggcttcccaagagaaa
cccagaccccacctgagcacggagcagaagcctaggactctgagccagaagtgtgacatc
tcattgcagatagaaccagcccacccagactcattctccagcttccaagaggagcagtcc
ttcagtgacctgggggtcaagtgcaaagggtctcgacacgaggaaaccatccagcggcag
agaaaggccttgtcggaactccgaacgcgagtcagagaactggagaaggccaactcctgc
aatcataaggaccacgtgaatgaatcgttcctagagctcaggaccctccggatggaaaaa
aatgtacagaaaatattattagacgcaaagcccgacttgacaactctcgcaagagtagag
atccgaccgcctcagaacagccctttcaactcgggctccaccttggtcatggagaagtcc
gtgaagacagacgctggggaagccttagaactcagtgagaagctgtacacggacatgatc
aagacgctcggcagcctgatgaacatcaaggacatgtccagccacacgtccctgaagcac
ctctcacccaaagagcgggagaaggtcaaccacctccgacagaaggacctggacctggtg
tttgataagatcactcagctcaagacccggcttcagaggaaagaggagctcctgaaggga
tacgagcaggaactggaacagctcaggcatagcaaagtgtccgttcagatgtaccagacg
caggtagccaaactggaggatgacgttcacaaagaggcagaggaaaaggcgctgctgaag
gaagccctggagcgcacagagcagcagctgagccaggaaaggagattcaacagggtcttc
aagcagcagaaggatcgaggagaggatccggagcagagaaacatgtcctacagccccttc
aaagacaatgagaagcagagacgcttgtttgttgagatggtcaagagcaagatgcagaac
tcaagtgtccaggctggagccaagaaagccaccctgaagacaggccaagagagagagaca
aagaaggaggcatacaagtcgacccagagcctttcatttgttaaacccggaggaaagaac
tag

DBGET integrated database retrieval system