KEGG   Mus musculus (mouse): 330222
Entry
330222            CDS       T01002                                 

Gene name
Sdk1, 5330440E10, 6720466O15Rik
Definition
(RefSeq) sidekick cell adhesion molecule 1
  KO
K16353  protein sidekick
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    330222 (Sdk1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Sidekick 1/2
   330222 (Sdk1)
SSDB
Motif
Pfam: fn3 Ig_3 I-set Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind Ig_5 Ig_6
Other DBs
NCBI-GeneID: 330222
NCBI-ProteinID: NP_808547
MGI: 2444413
Ensembl: ENSMUSG00000039683
Vega: OTTMUSG00000029307
UniProt: Q3UH53
Structure
PDB: 
5XWX 5K6U 5K6V 5K6W

Position
5; 5 G2
AA seq 2193 aa
MARARPSVAGGGVAAPPERAGPGRPRRSRTGHHCDPECPGLRAAPRTPGPGAGRRAAKLR
PGRGWWALLLLQLHLLRALAQDDVAPYFKTEPGLPQIHLEGNRLVLTCLAEGSWPLEFKW
IRNDSELTTYSSEYKYIIPSLQKLDAGFYRCVVRNRMGALLQRKSEIQVAYMGNFMDTDQ
RKTVSQGHAALLNLLPIVSCPQPQVTWFREGHKIIPSSRIAITLENQLVILATTASDAGA
YYVQAVNEKNGENKTSPFIHLSVARDTGTHEAMAPIIVVAPGNRSVVAGSSETTLECIAN
ARPVEELSVHWKRNGVRLTSGLHSYGRRLTITNPTSADTGMYVCEATLRGSTFEPARARA
FLSIIEPPYFTAEPESRILGEVEETMDIPCRAMGVPLPTLQWYKDAVPLSKLQNPRYKVL
PSGGLHIQKLSPEDSGIFQCFASNEGGEVQTHTYLDVTNIAPAFTQRPVDTTVTDGMTAV
LRCEVSGAPKPAITWKRGNHILASGSVRIPRFMLLESGGLRIAPVFIQDAGNYTCYAANT
EASVNASAMLTVWNRTSIVHPPEDRVVIKGTTATLCCGATHDPRTSLRYVWKKDNVVITA
SSSSRIVVEKDGSLVISQTWSGDIGDYTCEIISEGGSDSRTARLEVIELPHPPQNLLASL
SPARSHSVTLSWVRPFDGNSPVLYYIVQVSENNSPWKVHLSNVGPEMTGVTVSGLTPART
YQFRVCAVNQVGKGQYSTETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHN
GVLRGYILRYRLAGLPGEHQQRNISSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLGVFSR
AVTEYTLQGVPTAPPQNVQAEAVNSTTVHFLWNPPPQQFINGINQGYKLLAWPADAPETV
TVVTIAPDFHGIHHGYITNLKKFTAYFTSVLCFTTPGDGPPSSPQLVWTHEDKPGAVGHL
SFTEILDTSLKVSWQEPLERNGIIMGYQISWEVYGRNDSRLTHTLNSTMHEYKIQGLSSL
TTYTIDVAALTAAGVGVTTSSTISSGVPPDLPGAPSNLVISNISPRSATLQFRPGYDGKT
AICRWIVEGQVGAIGDEEEWVTLYEEENEPDAQMLEIPNLTPYTHYRFRMRQVNIVGPSP
FSQSSRVIQTLQAPPDVAPTSLTVRTASETSLRLRWVPLPDSQYNGNPESVGYRVKYWRS
DQPSSALAQVVSDRLERELTIEELEEWTEYELRMQAFNAIGAGPWSELVRGRTRESVPSA
APENVSAEAVSSTQILLTWASVPEQDQNGLILGYKVLYCAKDLDPEPRSHVVRGNHTQSA
LLAGLRKFVVYELQVLAFTRIGNGVPSSPLILERTKDDTPGPPVRLVFPEVRLTAVRIVW
QPPEEPNGVILGYQIAYRLASGSPHTFTTVEVGATVRQFTATELAPESAYIFRLSAKTRQ
GWGEPLEATVITTEKRERPAPPRELLVPQAEVTARSLRLQWVPGSDGASPIRYFTVQVRE
LPGGEWQTYSSSISHEATACAVERLRPFTSYKLRLKATNDIGDSDFSAETEAVTTLQDVP
GEPPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRELESETGMSPEPKTLKSPS
ALRAELTAQSSFKTVNSSSSLTTYELTHLKKYRRYEVIMTAYNIIGESPASVPVEVFVGE
AAPAMAPQNVQVTPLTASQLEVTWDPPPPESQNGNIQGYKVYYWEADSRNETEKMKVLFL
PEPVVKIKDLTSHTKYLISISAFNAAGDGPKSDPCQGRTHQAAPGPPSFLAFSEITSTTL
NVSWGEPSAANGILQGYRVVYEPLAPVQGVSKVVTVDVKGNWQRWLKVRDLTKGVTYFFR
VQARTIAYGPELQANVTAGPAEGSPGSPRNVLVTKSASELTLQWTEGNAGTTPTTGYVIE
ARPSDEGLWDMFAKDIPRSATSYTVDLDKLRQGVTYEFRVVAVNKAGFGEPSRPSIAVSA
QAEAPFYEEWWFLLVMALSSLLLILLVVFVLVLHGQSKKYKSCSTGKGISNMEETVTLDN
GGFAALELNSRHLNVKSTFSKKNGTRSPPRPSPGGLHYSDEDICNKYNGAVLTESVNLKE
KSVDGSESEASDSDYEEALPKHSFVNHYMSDPTYYNSWKRRPPAAAPHRYEAVAGAEAGP
HLHTVITTQSAGGVYTPAGPGARAPLTGFSSFV
NT seq 6582 nt   +upstreamnt  +downstreamnt
atggcccgcgcccggccctcggtggcgggcggcggagtcgcggcgccccctgagcgagcg
gggcccgggcggccgcggaggagccggaccggtcaccactgcgaccccgagtgcccaggg
ctgcgcgcagcgcccaggacccccgggccgggcgcgggccggcgggcggcaaagttgagg
ccgggccgcgggtggtgggcgctgctgttgctccagctgcacttgctgcgggcgctggcg
caagatgacgttgcaccgtatttcaaaacggagccgggcctgccacagatccacctggaa
gggaaccgcctggtgctcacctgcctggctgaagggagctggcctctggaattcaagtgg
atacggaacgacagtgagcttaccacctacagcagcgaatataagtatatcatcccctct
ttgcagaagctggacgccgggttttaccgctgcgtggtgcggaacaggatgggagctctc
ttgcagagaaaatcagaaattcaagtagcatatatggggaacttcatggatacagaccag
aggaaaacagtttctcaagggcatgcggcacttctcaacttactgcctatcgtcagctgc
ccccaacctcaagtgacgtggtttagagaaggacacaagattattcccagcagcagaata
gccatcacattggagaatcagctggtgatccttgctacaacagcgagtgatgctggggct
tactacgtgcaggctgtgaatgagaagaacggagagaacaagacaagcccgttcatccac
ctgagcgtagcacgagatactggtacccacgaggccatggccccaatcatcgtggttgcc
ccaggcaacagaagtgtggtagcagggtccagtgagaccaccttggagtgcatagccaat
gccaggcccgtggaggagctgagtgtgcactggaagagaaacggagttcgactcacaagt
ggactacacagctacgggaggcgccttaccatcaccaatccgacatcagcagacaccggg
atgtacgtgtgcgaggcgacactccgggggagcacatttgagccagccagggccagagcc
ttcctttccatcatagagccaccatatttcactgctgagccagagagtcggattttaggg
gaagtggaagaaactatggacatcccatgtcgagccatgggggttcctcttcccactctc
cagtggtacaaagatgctgttcccctcagcaaactccagaaccctaggtataaagttctc
cccagcggaggcctccacattcagaagttgagtccagaagactctggaatcttccagtgc
tttgccagtaacgaaggaggagaggtccagactcacacctacctggatgtgaccaatatt
gctcctgccttcacccagcgtccagtggacaccacggttactgacgggatgacggctgtc
ctgaggtgtgaggtgtccggagctcccaaacccgccatcacatggaagagagggaaccac
attctggccagtggctctgtccggattcctaggttcatgctgctggaatctggggggctg
agaatagcccccgtcttcatccaggatgctggcaactacacctgctatgcagccaacacg
gaggcttctgtgaacgcctccgccatgctcaccgtgtggaatcgaacgtccatcgttcac
cctccagaagaccgcgtggtgattaaggggacgacggccaccctgtgctgcggagctacc
cacgaccctcggacctctctccgctacgtttggaaaaaggacaacgtggtcatcacagcg
tctagcagctccagaattgtggtggaaaaggatgggtcgcttgtcattagccagacgtgg
tcaggggacattggtgactacacctgtgaaatcatatccgagggagggagtgactcccgg
acggcacggctggaagtgattgagctgcctcacccacctcaaaacctgctggccagcttg
agtccagcacgcagccactcggtgacactatcttgggttcggccctttgatggaaacagc
ccggtcctttactacattgtgcaagtatctgaaaacaactctccatggaaagtgcatttg
tcaaatgttggcccggagatgacaggcgtcactgtgagtggcttgactccagcccggacc
tatcagttcagggtgtgcgctgtgaatcaagtgggcaagggccagtacagcacagagaca
agcagattgatgttacccgaagaaccaccgagtgctcccccaaaaaacattgtggccagt
gggagaaccaaccagtccatcatggtacagtggcagccaccacccgaaacagagcacaat
ggggtgcttcggggctacatcctcaggtaccgcctggctggcctgcctggggaacaccag
cagaggaacatcagcagcccagaggtgaactactgcctggtcaccgacctcatcatctgg
acccagtatgagatccaggtggctgcctacaacggggcaggcctgggtgtcttcagcagg
gcagtgaccgagtacaccttacaaggagtgcccactgcacctccccagaacgtgcaggca
gaggctgtgaattccaccactgtgcacttcctgtggaacccgccaccccagcagttcatc
aacggcatcaaccagggatacaagctcctagcatggccggcagatgctcctgagactgtc
actgtagtcactattgctcctgacttccatggaatccatcatgggtacataacaaacttg
aagaagttcactgcctacttcacatccgtcctgtgttttaccaccccgggggatgggcct
ccaagttcacctcagctcgtgtggacccatgaggacaagccgggagctgtggggcacctg
agcttcacggagattttggacacctctctcaaggtcagctggcaggagcccctggagaga
aacggcatcattatgggctatcagatttcctgggaggtgtatgggaggaatgactctcga
ctcacgcacaccctcaacagcacgatgcacgagtataagatccaaggactgtcatcactc
accacctataccatcgatgtggctgccttgaccgccgcaggcgtgggcgtgaccacatca
tccaccatctcttcaggtgtacccccagatcttcctggcgctccatccaatctggtcatt
tccaacatcagccctcgctcagccacactccagttccgacctggctatgatgggaagacg
gccatctgcaggtggattgtggaggggcaggttggtgccatcggggacgaggaggagtgg
gttaccctctatgaggaggagaatgagcccgatgcccagatgttggagataccaaacctc
acaccctacacacactacaggtttcgaatgaggcaagtgaacatcgtgggtcccagcccc
ttcagccagtcatccagggtcatccagaccctacaggccccacctgatgtggctccaacc
agcctcactgtccgaacagccagtgagaccagcctgaggctacgctgggtgcctctgcct
gattcccagtacaatgggaaccctgagtctgtgggctacagggtgaagtattggcgttct
gaccaaccatcgtcagctctggcccaagttgtcagtgaccgtctggagagggagctgacc
atcgaggaactggaggagtggacagagtacgagttgcggatgcaggccttcaacgccatt
ggggctgggccctggagtgagctggtgcggggccgcacgcgggagtcagttccttcagca
gctcctgaaaatgtgtctgcagaggctgtcagctccacccagatcctactgacttgggct
tcagttcctgagcaggaccagaatgggctcatcctaggctacaaggttctatactgtgcc
aaagacctggacccagagcccagaagccacgtggtacgagggaaccacacgcagtctgcg
ctgctggctggcctgcgaaagttcgtggtctatgagctccaagtgctggcgttcacacgg
atcgggaatggggtccccagctcacctctcatcctggagcgcaccaaagatgacacccca
ggtccccccgtgcggctggtgttccccgaagtaagacttactgcagtgcggattgtgtgg
cagcccccagaggagcccaatggtgtgattctggggtaccagatcgcctaccgcctggcc
agcggtagtcctcacaccttcaccactgttgaggtgggtgccacggtgcggcaattcaca
gccacagagctggccccggagtctgcctacatcttcagactgtctgctaagacgagacag
ggttggggtgagcccctggaggccacagttatcactactgagaagagagagaggccagcg
ccccccagagagctcctggtaccccaggctgaagtgacagctcgtagcctcaggctccag
tgggtccctggcagtgatggggcctctccgatccggtacttcacggtgcaggtgcgagag
ctgccaggtggagagtggcagacctactcctcatctatcagtcatgaggccacagcctgt
gctgttgagaggctgaggcctttcacctcctacaagctgcgcctgaaggccaccaatgac
attggggacagtgacttcagtgcagaaacagaggctgtgaccactttgcaagatgttcca
ggagagccaccagggtctgtctcagccacaccgcacaccacgtcctccgttctgatccag
tggcagcctccccgggatgagagcctgaacggtcttctgcaaggctacaggatctactac
cgtgagctggagtctgagacaggcatgagccctgagcccaagacactcaagagcccctct
gccttacgtgctgaactcaccgctcaaagcagcttcaagaccgtgaacagcagctcctcg
ttaaccacctatgaattaacacatctgaagaagtaccggcgctatgaagtcatcatgact
gcttataacatcattggtgagagcccagccagtgtaccagtggaagtcttcgttggtgag
gctgccccagcgatggccccacagaatgtccaggtgaccccactcacggccagccagctg
gaggtcacatgggacccaccgcccccagagagccagaatgggaacatccagggttataag
gtttactactgggaggcagacagtcgcaatgagacagagaaaatgaaggtcctcttcctc
cccgagcctgtggtgaagatcaaggatctcaccagccacacaaagtacctgatcagcatc
tcagccttcaatgctgctggtgatgggcccaagagtgacccgtgccaaggacgcacacat
caggcggctccagggccccccagcttcttggcattctcagaaataacttctaccacactc
aacgtatcctggggagagccatcagctgccaacggcatcctacagggctatcgagtggtg
tatgagcccttagcaccagtgcaaggcgtgagcaaggtggtgaccgtggacgtgaaaggc
aactggcaacgttggctgaaggtgcgggacctcaccaagggagtgacctacttcttccgt
gtccaggcgcggaccatcgcctacgggccggagctccaagccaatgtcactgcagggcca
gccgaggggtccccaggctcaccaagaaatgtccttgtcaccaaatctgcctctgagctg
acccttcagtggacagagggaaatgctggtaccacacccactacaggctacgtcatagaa
gccaggccatcagatgaaggcttatgggacatgtttgcaaaggacattcccaggagtgct
acatcatacactgtggacctggataagttgcggcaaggggtgacctacgagttccgggtg
gtggctgtgaacaaggcaggctttggggagcccagccgcccttccattgcagtgtcagca
caagctgaagccccgttctacgaggagtggtggttcctgctggtgatggcgctctccagc
cttctcctcatcctcctggtggtcttcgtgctggtcctgcatggacaaagcaagaagtac
aagagctgcagcacaggtaagggcatctccaacatggaggagacagtgaccctggataac
ggaggttttgccgccttggagctcaacagccgccacctcaatgtcaagagcaccttctca
aagaagaacggaaccagatctccaccccgaccaagccccggaggtcttcactactctgac
gaggacatctgcaacaaatacaacggcgccgtgctgacggagagtgtgaacctcaaggag
aagtcggtggatgggtcggaatccgaggcctctgactcagactatgaggaagccctgccc
aagcactccttcgtcaaccactacatgagcgaccccacctactacaactcttggaagcgg
cgtccccctgccgcagcaccacataggtacgaggcggtggcaggggcagaagccggccca
cacctgcacacggtcatcaccacacagagcgcgggcggagtctacacaccagctggcccc
ggagcccgggcccccctcaccggcttctcctccttcgtgtga

DBGET integrated database retrieval system