KEGG   Mus musculus (mouse): 330450
Entry
330450            CDS       T01002                                 

Gene name
Far2, A230046P18, AW048109, BC055759, Mlst, Mlstd1
Definition
(RefSeq) fatty acyl CoA reductase 2
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    330450 (Far2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    330450 (Far2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     330450 (Far2)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind Semialdhyde_dh GDP_Man_Dehyd KR
Other DBs
NCBI-GeneID: 330450
NCBI-ProteinID: NP_001334445
MGI: 2687035
Ensembl: ENSMUSG00000030303
Vega: OTTMUSG00000026047
UniProt: Q7TNT2
Position
6; 6 G3
AA seq 515 aa
MSMIAAFYSNKSILITGATGFLGKVLMEKLFRTSPHLKVIYILVRPKSGQTLQERVFQIL
NSKLFEKVKEVCPNVHEKIRPISADLNQRDFAISKEDVQELLSCTNIIFHCAATVRFDAH
LREAVQLNVTATQQLLLMASQMPKLEAFIHISTAFSNCNLSHIDEVIYPCPVEPRKIIDS
MEWLDDSIIEEITPKLIGDRPNTYTYTKALGEIVVQQESGNLNVAIVRPSIVGATWQEPF
PGWVDNLNGPSGLIIATGKGFLRSIKATPMAVADVIPVDTVVNLTIAVGWYTAVHRPKST
LIYHSTSGNLNPCNWYKMGLQVLATIEKIPFESAFRRPNADFTTSNFTTHYWNTVSHRVP
AIIYDFYLRLTGRKPRMLKLMNRLLKTISMLEYFINHSWEWSTNNTEMLLSELSPEDQRV
FNFDVRQLNWLEYIENYVLGVKKYLLKEDLAGIPKAKQHLRRLRNIHYLFNTALFLIIWR
LLIARSQMARNVWFFIVSFCYKFISYFRASSTLKV
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtccatgatcgcagctttctacagcaacaagtctatcctcatcacaggggccacaggc
ttcctgggcaaggtgctcatggagaagttattccgtaccagcccccacttgaaagtcatt
tacatcctcgtgagacccaagtctggacagacactgcaggaaagggttttccagatcctc
aacagtaagctgtttgagaaagtcaaagaagtctgtccaaatgtgcatgagaagatcaga
cccatctccgcagacctcaaccagcgtgacttcgccatcagcaaggaagacgtgcaagaa
cttctgtcctgtaccaatattatcttccactgtgcagccacagtgcgctttgatgcacat
ctgagagaagctgtgcagctgaacgtcacggccacccagcagctcctgctaatggccagc
cagatgccaaagctggaagccttcatccacatctccactgccttttccaactgcaacctg
agccacattgatgaggtcatctacccatgccctgtggagccaagaaagatcattgactcc
atggagtggttagatgactctatcattgaagagatcactcctaagctgattggggaccgg
cccaatacctacacctacaccaaagccttgggagagatagtagtgcagcaagagagcgga
aacctgaatgtggccattgtcaggccatccatagtgggagcaacctggcaggagcctttc
ccgggttgggttgataatctaaatggacccagcggactcattattgcgactgggaaagga
tttcttcggtccataaaagcgactcccatggcagtggcagatgtgattccagttgacaca
gttgttaatctcaccatagcagtaggatggtatactgcagttcataggcctaaatcaaca
ttaatctaccattccacatctggtaatctcaatccctgtaactggtataaaatgggatta
caggtcttggcgaccatcgaaaagatcccatttgagagtgctttcagaaggccaaatgct
gacttcaccaccagcaatttcaccacccattattggaacaccgtcagccaccgggtccca
gccatcatctatgacttctatctgaggcttactggaaggaaacccagaatgctgaagctc
atgaaccggctgctaaaaaccatttccatgctggagtatttcatcaaccacagttgggaa
tggagcacaaacaacacggagatgcttctgtcagagctcagtcctgaagaccagagagta
ttcaactttgatgtgcgtcagttgaactggctcgaatacattgaaaattacgttttgggg
gttaagaagtatctactaaaagaggatctggccggtatccccaaagcaaagcaacaccta
agaaggctccggaacattcactacctctttaacactgccctgtttcttatcatctggcgc
ctcctcattgcaaggtctcagatggctcggaacgtctggttcttcattgtaagcttctgt
tacaagttcatctcctactttcgggcctccagcacactcaaggtctaa

KEGG   Mus musculus (mouse): 67420
Entry
67420             CDS       T01002                                 

Gene name
Far1, 2600011M19Rik, 2900034E22Rik, 3732409C05Rik, AI850429, Mlst, Mlstd2
Definition
(RefSeq) fatty acyl CoA reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    67420 (Far1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    67420 (Far1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     67420 (Far1)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 Semialdhyde_dh RmlD_sub_bind 3Beta_HSD GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 67420
NCBI-ProteinID: NP_001272760
MGI: 1914670
Ensembl: ENSMUSG00000030759
Vega: OTTMUSG00000031364
UniProt: Q922J9
Position
7; 7 F1
AA seq 515 aa
MVSIPEYYEGKNILLTGATGFLGKVLLEKLLRSCPRVNSVYVLVRQKAGQTPQERVEEIL
SSKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEIIIDSTNVIFHCAATVRFNEN
LRDAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDS
LEWMDDGLVNDITPKLIGDRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPF
PGWIDNFNGPSGLFIAAGKGILRTMRASNNALADLVPVDVVVNTSLAAAWYSGVNRPRNI
MVYNCTTGSTNPFHWGEVGDYLNHSFKMNPLNQVFRHPYVKFCSNNLMLHYWKGVKHTVP
ALLLDLALRLTGQKPWMMKTITRLHKAMVFLEYFTSNSWVWNTDNVNMLMNQLNPEDKKT
FNIDVRQLHWAEYIENYCMGTKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVILIWR
IFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggtttcaatcccagaatactacgaggggaagaatatccttctcacaggagccactggt
ttcttaggcaaggtgcttctggaaaagttgctgagatcttgtcccagggtgaattctgtc
tatgttttggtgaggcaaaaagctggtcagacaccccaagagcgagtggaggaaatcctc
agtagcaagcttttcgacaggttgagagatgaaaatccagattttagagagaaaattata
gcgatcaacagtgaacttacccaacctaaactggctctcagtgaagaagataaggagatc
attatagattctacaaatgtcatattccactgtgcggctactgtaagatttaatgaaaat
ttaagagatgctgtccagttaaatgtgatagctacacgacagcttattctccttgcacag
caaatgaagaatctggaagtgttcatgcatgtctcaacagcgtatgcctactgcaatcga
aagcatattgatgaagtagtttatccaccccctgtagatcccaagaagctgattgattct
ttagaatggatggatgatggcctagtaaatgatatcacaccaaaattgataggcgacagg
cctaacacgtacatatacaccaaggcattggcagagtatgttgtgcagcaggaaggagca
aagctaaatgttgccattgtaaggccgtcgatcgtcggcgccagttggaaagaacctttt
ccaggatggattgataactttaatggaccaagtggtctcttcattgcggcagggaaagga
attcttcgaacaatgcgtgcctccaacaatgcccttgcagatctcgttcctgtagatgta
gtggtcaacacgagccttgctgcagcctggtattctggagttaatagaccaagaaacatc
atggtgtataattgcacaacaggcagcactaatcctttccactggggggaagttggagat
tatctaaatcattccttcaagatgaatcctttaaaccaagtattcaggcacccctatgtt
aaattctgttccaacaacctaatgcttcattattggaagggtgtcaaacatacagtacct
gcattattgctcgatcttgctctcaggttgacaggtcagaaaccgtggatgatgaaaaca
atcactcgtcttcacaaagccatggtattccttgagtattttacaagtaactcttgggtt
tggaatactgataatgtcaatatgttaatgaaccaactaaaccctgaagataaaaagacc
tttaatattgatgtacggcagttacattgggcagaatatatagaaaactactgcatgggg
actaagaagtacgtgttgaatgaagagatgtctggcctccctgctgctcggaagcatctc
aacaagttgcggaatatccgttatggtttcaatacaatccttgtgatacttatctggcgc
atttttattgcaagatcacaaatggcaagaaacatctggtattttgtggttagtctgtgt
tacaaatttctgtcatacttccgagcatccagcactatgagatactga

DBGET integrated database retrieval system