KEGG   Mus musculus (mouse): 330662
Entry
330662            CDS       T01002                                 

Gene name
Dock1, 9130006G06Rik, AI854900, D630004B07Rik, Dock18, b2b3190C, b2b3190Clo
Definition
(RefSeq) dedicator of cytokinesis 1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    330662 (Dock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    330662 (Dock1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    330662 (Dock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    330662 (Dock1)
   05100 Bacterial invasion of epithelial cells
    330662 (Dock1)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    330662 (Dock1)
SSDB
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_1 SH3_9 SH3_2 SR-25
Other DBs
NCBI-GeneID: 330662
NCBI-ProteinID: NP_001028592
MGI: 2429765
Ensembl: ENSMUSG00000058325
Vega: OTTMUSG00000060293
UniProt: Q8BUR4
Structure
PDB: 
2M0Y

Position
7; 7 F3
AA seq 1865 aa
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEVASKQVEERLQEEKSQKQNMDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPMESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDSNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQAVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETLKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKGELEEKGHSATGKGMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTNLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLR
TYVASAEKPGVNEQLYKAIKALEYIFKFIVRSRVLFNQLYENKGEADFVESLLQLFRSIN
DMMSSLSELTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPAGLLTVQKLSC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEELEACCQLLSNILEVLYRKDVGPTQ
RHVQIIMETLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNTMQNKVFLRAINQYADMLNKRFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATLPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKDNRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCAAHLTQ
RDGFQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYETEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPSFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKTSPGQYIQCFTVKPKLDLPPRFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKISSMVQQHLDDPGLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHGQ
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKQYGVRTMPSG
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSFSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDPDKEKKDKKKEKRNSKHQEIFDKEFKPADSSLQQSEAVILSETISPLRPQR
PKSQVINVIGNERRFSVSPASPSSQQTPPPVTPRAKLSFSIQPSLELNGMMGMDVADVPP
PLPLKGNMADYGNLMENQDMMVSPTSPPPPPPQRQQPPPLPSKTPPPPPPKTTRKQTSVD
SGIVQ
NT seq 5598 nt   +upstreamnt  +downstreamnt
atgacgcgctgggtccccaccaagcgagaggagaagtacggcgtggccttttacaactac
gatgccaggggagcagatgaactgtcccttcaaattggagacaccgtgcacatcctagaa
acttatgaagggtggtacagaggctacaccttaaggaaaaagtctaaaaagggtatattt
cctgcttcatatattcatcttaaagaagccattgttgaaggaaaagggcaacatgaaacc
gtcatccctggggacctcccccttatacaggaagtcaccacaacgcttcgagagtggtct
accatctggaggcaactttatgtgcaagataatagagagatgtttcgaagtgtgcgacac
atgatctatgaccttattgaatggcggtcgcagatcctttctggaactctgccccaggat
gagctcaaagagctgaagaagaaggtcacagccaaaattgattatggaaacagaattctt
gatttggacctggtggtgagggatgaagatgggaacattttggacccggaactaactagc
accatcagtctcttccgagcacacgaagttgcttctaaacaagtggaggagagactgcaa
gaggagaaatctcaaaagcagaacatggatatcaacagacaagccaagtttgcagccacc
ccatcgctggccttgtttgttaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagttctcatgtctctttatgaccccatggagtccaaattcatcagtgagaactatctg
gtccgctggtcaagttcaggattaccaaaagatattgatcggttacataacttgcgagct
gtgtttacggatctggggagcaaagacttgaaaagggagaaaattagtttcgtctgccag
attgtccgtgtcggtcgcatggagctgagggacagcaacacgaggaagctgacttcgggg
ctgcggcgacctttcggcgtggctgtgatggatgtgacagacataataaacgggaaagtc
gatgatgaagataaacagcatttcatccccttccaggcggtggcaggggagaatgacttc
cttcaaactgtcataaacaaagtcattgcagccaaagaagtcaaccacaagggacaaggt
ttgtgggtaaccttgaaattacttcctggagacatccatcagattcggaaggagtttcct
cacttggtggacaggaccacagctgtggcccgcaagacagggtttcctgagattattatg
ccaggtgatgttcgaaatgatatctatgtgacattagttcaaggggattttgataaaggc
agtaaaacaactgcgaagaacgtggaggtgacagtgtctgtctatgatgaagatgggaag
cgattggagcacgtgattttccccggtgctggcgacgaggcgatctccgagtacaaatcg
gtgatttattatcaagtgaagcagcctcgctggtttgagacccttaaggtggccatcccc
attgaggacgtgaaccggagtcaccttcgattcaccttccgccatagatcctcgcaggac
tccaaggataaatctgaaaagatcttcgcactggcctttgtgaagctgatgagatacgat
gggaccaccctgagagacggggagcatgaccttattgtctacaaggctgaagccaaaaag
ctcgaagatgcagccacatacttgagcctccctagtaccaagggggagttggaagaaaag
ggccactcagccacaggcaaaggaatgcagagtcttgggagttgtaccatcagcaaagac
tctttccagatctccactctggtgtgttccacgaaactgacccagaacgtggacctcctg
gggctgttgaagtggagatccaacaccaaccttctgcagcagaacttgaggcagttgatg
aaggtggacggtggtgaagtggtgaagttccttcaggacaccttggatgccctcttcaac
atcatgatggagaactcagagagtgagacgtttgataccttggtgtttgatgctctggtc
tttattattggactaatcgcggataggaaatttcagcattttaatcctgttttggagact
tacattaagaaacacttcagtgcaacattagcctacacgaagctgaccaaggtgttacgg
acctacgtggccagcgcagagaagccgggagtcaacgagcagctgtacaaagccataaaa
gccttggagtacatcttcaagttcatagtgcgctcacgggtactgttcaaccagctgtat
gaaaacaagggggaagctgacttcgtggagtccttgttgcagctgttccggtccatcaac
gacatgatgagcagcctgtcagagctcacagtcagggtgaagggggcagccctgaagtac
ttgccgacgatcgtcaatgatgtgaagttggtgtttgatcccaaggagctcagcaaaatg
ttcacggaattcatcctgaatgtccctgcgggcttgctgacggtccagaagctctcctgc
ctgattgagattgttcacagtgacctcttcacacagcatgactgcagagagatcctgctc
cccatgatgacagaccagctcaagtaccacctggagaggcaggaggagctggaggcttgt
tgccagctgcttagcaacatcctggaggtgctataccggaaggatgtgggaccgactcag
aggcacgtccagatcatcatggagacgctgcttaggactgtgaacaggacggtcatttcc
atggggcgggactccgagctcattgggaactttgtggcttgcatgacagccattttacgg
cagatggaagactaccattatgcacacctgatcaagacctttgggaaaatgaggacagat
gtcgtggattttctgatggagacattcatcatgtttaagaacctcatcgggaagaacgtc
taccccttcgactgggtgataatgaacacgatgcagaacaaagtctttctgcgggcgatt
aatcagtatgcagatatgctgaacaagagatttctggatcaagccaactttgagctgcag
ctgtggaacaactactttcacctggccgtggctttcctcactcaagagtccctgcaactg
gagaatttttcaagtgctaagagagctaaaatccttaacaagtatggagacatgaggagg
cagattggctttgagatcagagacatgtggtacaacctgggtcaacacaagataaaattc
atcccagaaatggttggcccaatattggaaatgacattgattcctgagacagagcttcga
aaagccacccttcccatcttcttcgacatgatgcagtgtgaattccactccacccggagc
tttcaaatgtttgaaaatgagatcatcactaagctggatcatgaagtggaaggaggcaga
ggagacgagcaatacaaagtgttatttgataaaatcctcctggagcactgcaggaagcat
aaatacctcgccaagacaggagaaacttttgtgaagctcgtagtgcggttgatggagagg
ctcctggactacaggaccatcatgcatgacgaaaacaaagacaatcggatgagctgcacc
gtcaacgtgctgaatttctacaaagaaattgaaagagaagagatgtatataaggtacttg
tataagctctgtgacctgcacaaagagtgtgacaactacacagaggcggcctacactttg
cttctgcacgcgaaacttctaaagtggtcagaggacgtgtgtgcagctcacctcactcag
cgggacgggttccaggcgacaacacagggacagctgaaagagcagctctaccaagaaatc
atccactactttgacaaaggcaagatgtgggaggaggccatcgccctgggcaaggaactt
gcggagcagtacgaaacagagatgtttgattatgagcagctcagtgaattgctgaaaaaa
caggcacaattttacgagaacatcgtgaaggtgataagacccaagcctgactattttgct
gttggctactatgggcaagggttcccgtcattccttcggggcaaagtgttcatttaccga
ggcaaggaatatgagcgacgggaagattttgaagctcggctgttaactcagtttccaaat
gctgaaaaaatgaagacgacgtctccaccgggcgatgacattaagacttctcccggccag
tacatccagtgcttcacagtgaagcccaagctagacttacctccgagatttcaccgaccc
gtgtctgaacagattgtaagtttttacagggtgaatgaggtacagcgattcgagtattca
cggcccatccggaaaggagagaaaaacccagacaatgaatttgcgaatatgtggattgaa
agaaccatctacactacggcctataaactgccaggaattttaaggtggtttgaagtcaaa
tctgtcttcatggtagagatcagcccactggagaatgccatcgagacaatgcagttgacc
aatgacaagatcagcagcatggtccagcagcacctggatgacccgggcctgcctatcaac
cccctgtccatgctcctgaatggcattgtggatcctgctgtcatgggtggttttgccaat
tatgagaaggctttcttcacagacagatacctgcaggagcatcctgaggcccatgggcag
attgagaagctcaaggacctgatagcctggcagattccatttttggctgaagggatcagg
attcatggagacaaagtcacagaggccctgaggccattccacgagcgcatggaagcctgc
ttcaagcaactgaaggaaaaagtggaaaagcaatatggcgtcaggaccatgccctcaggc
ttggatgacaggagaggcagccgtccacgttcaatggtgcgatctttcaccatgccatca
tcctcccggcccctgtcagtggcttccgtctcttctttctcctctgacagcactccttcc
aggccaggctctgatggatttgctctagagcctctgctgccgaagaagatgcactccagg
tcccaggacaagctagacaaggacgatccagataaagagaagaaggacaagaagaaggag
aaaaggaacagcaaacaccaagagatatttgataaggaattcaagcccgctgacagctcc
ctgcagcagtctgaggctgtgatcctttctgaaacgataagtcccctgcggccccaaaga
cccaagagccaggtgatcaatgtcattggaaatgaaaggcgcttctctgtgtctccagca
tcaccgtcctcccagcagacgccccctccagtcacaccaagagccaagctcagcttcagc
attcagcccagtctggagctgaacggcatgatgggaatggatgtggccgatgtcccaccc
cctctgcccctcaaaggcaacatggcagattatggaaatctgatggaaaaccaggatatg
atggtctcacccacatctccacctcctcctcccccacaacggcaacagccacctccactg
cccagcaaaacaccacctcctccccctccgaagacgacccgaaagcagacctcagtggac
tctggaatcgtgcagtga

DBGET integrated database retrieval system