KEGG   Mus musculus (mouse): 330953
Entry
330953            CDS       T01002                                 

Symbol
Hcn4, Bcng3, Hcn3
Name
(RefSeq) hyperpolarization-activated, cyclic nucleotide-gated K+ 4
  KO
K04957  hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    330953 (Hcn4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    330953 (Hcn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    330953 (Hcn4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   330953 (Hcn4)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 330953
NCBI-ProteinID: NP_001074661
MGI: 1298209
Ensembl: ENSMUSG00000032338
Vega: OTTMUSG00000063286
UniProt: B2RY58
Position
9; 9 B
AA seq 1201 aa
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDGEEEGAGGRQDPSRRSIRLRPLPSPSPSV
AAGCSESRGAALGATESEGPGRSAGKSSTNGDCRRFRGSLASLGSRGGGSGGAGGGSSLG
HLHDSAEERRLIAAEGDASPGEDRTPPGLATEPERPATAAQPAASPPPQQPPQPASASCE
QPSADTAIKVEGGAAASDQILPEAEVRLGQSGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVRHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPAAIFRPPPGPGLGNLGAGQTPRHPRRLQSLIPSALGSA
SPASSPSQVDTPSSSSFHIQQLAGFSAPPGLSPLLPSSSSSPPPGACGSPPAPTPSTSTA
AAASTTGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPPPPLPGARGGLGLLEHFL
PPPPSSRSPSSSPGQLGQPPGELSLGLAAGPSSTPETPPRPERPSFMAGASGGASPVAFT
PRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT
QDLKLISASQPALPQDGAQTLRRASPHSSGESVAAFSLYPRAGGGSGSSGGLGPPGRPYG
AIPGQHVTLPRKTSSGSLPPPLSLFGARAASSGGPPLTTAAPQREPGARSEPVRSKLPSN
L
NT seq 3606 nt   +upstreamnt  +downstreamnt
atggacaagctgccgccgtccatgcgcaagcggctctacagccttccgcagcaggtgggg
gccaaggcgtggatcatggacgaggaagaggatggtgaggaagaaggggccgggggccgc
caggaccccagccgaaggagcatccggctgcggccgctgccctcgccctctccctcggtg
gctgcgggctgctcggagtcccggggtgcggccctcggggcgacagagagcgaggggccg
ggccgcagcgccggcaagtccagcaccaacggtgactgcaggcgcttccgcgggagtctg
gcctcgctgggcagccggggcggcggcagtggtggagcagggggcggcagcagtctcggg
cacctgcatgactccgcggaggaacggcggctcatcgccgctgagggcgatgcgtccccc
ggcgaggacaggacgcccccgggcctggcgaccgaacccgagcgcccggccaccgcggca
caacccgcagcctcgccgccgccccagcagccgccgcagccggcctctgcctcctgcgag
cagccctcggcggacaccgctatcaaagtggagggaggcgcggccgccagcgaccagatc
ctccccgaggccgaggtgcgcctgggccagagcggcttcatgcagcgccagttcggtgcc
atgctgcaacctggggtcaacaaattctccctaaggatgttcggcagccagaaagcggtg
gagcgcgagcaggagagggttaagtcagcagggttttggattatccacccctacagtgac
ttcagattttactgggacctgacgatgctgttgctgatggtggggaatctgatcatcata
cccgtgggcatcaccttcttcaaggatgagaacaccacaccctggatcgtcttcaatgtg
gtgtcagacacattcttcctcattgacttggtcctcaacttccgcacggggatcgtggtg
gaggacaacacagaaatcatccttgacccgcagaggatcaagatgaagtacctgaaaagc
tggtttgtggtagatttcatctcctccatccctgtcgactacatcttccttatagtggag
actcgcattgactcggaggtctacaaaaccgctagggctctgcgcattgtccgtttcact
aagatcctcagcctcctgcgcctcttgaggctttcccgcctcattcgatacattcatcag
tgggaagagatcttccacatgacctatgacctggccagcgccgtggtacgcatcgtgaac
ctcattggcatgatgcttctgctgtgtcactgggatggctgcctgcagttcctagtgccc
atgctgcaggacttcccccatgactgctgggtgtccatcaatggcatggtgaataactcc
tgggggaagcagtattcctacgccctcttcaaggccatgagccacatgctgtgcattggg
tatggacggcaggcacccgtaggcatgtctgacgtctggctcaccatgctcagcatgatc
gtgggggccacctgctatgccatgttcatcggccacgccactgccctcatccagtcgcta
gactcctcccggcgccagtaccaggagaagtataaacaggtggagcagtacatgtccttc
cacaagctcccgcctgacacccgacagcgcatccatgactactatgaacaccgctaccaa
ggcaagatgtttgatgaggaaagcatcctgggtgagctgagtgagccacttcgagaggag
atcatcaactttaactgccgaaagctggtggcatccatgccactgtttgccaacgcagat
cccaactttgtgacatccatgctgaccaagttgcgtttcgaggtcttccagcctggggat
tacatcatccgcgaaggcaccatcggcaagaagatgtactttatccagcacggcgtggtc
agcgtgctcactaagggcaacaaagagaccaagctggctgatggctcctattttggagag
atctgcttgctgacccggggtcggcgcacagccagcgtcagagcggatacttattgccgc
ctctactcactgagcgtggacaacttcaatgaggtgctggaggagtatcccatgatgcgg
agggccttcgagacggttgcgctggaccgcctggaccgcataggcaagaagaactccatc
ctcctccacaaggtgcagcacgacctcaactcaggcgtcttcaactaccaagagaacgag
atcatccagcagatcgtgcggcatgaccgtgagatggcccactgtgctcaccgcgtccag
gctgccgcctcagccaccccaacccccacgcctgttatatggaccccgctgatccaggcg
ccactgcaggctgctgctgctactacttcggtggccatagccctcacacaccacccccgc
ctgcccgccgccatcttccggccccctcccggacctgggctgggcaaccttggggctgga
cagacaccgaggcacccaaggaggctgcagtccttgatcccttcagctctgggctctgct
tcacccgccagcagcccctcacaggtggacacaccgtcttcatcctccttccacatccaa
cagctggctggattctctgcacctcctggattgagccctctcctgccctcctctagctct
tccccacctccaggagcctgcggttccccaccagcccccacaccctccacctccactgcc
gccgccgcctccaccactgggttcggccactttcacaaggcgctgggtggctccctgtca
tcctctgactccccgctgctcaccccactgcaaccaggcgctcgctctccacaggctgcc
cagccaccacccccactgcctggggcccgaggaggtctgggactcctggagcacttcttg
ccgcccccaccctcctccaggtcaccatcatccagccctgggcagctgggccagcctcct
ggagagttgtccctaggtctggcagctggtccatcaagtacaccagagacacccccacgg
cctgagcgaccatccttcatggcaggggcctctggaggggcttctcctgtagcctttacc
ccccgaggaggcctcagtcctccgggccacagcccggggcccccaagaactttcccgagt
gccccaccccgggcctctggctcccatggttccctgctcctgccacctgcatccagccct
ccacctccccaggtcccacagcgcaggggcacaccacccctcacccctggccgcctcaca
caggacctgaagctcatctcagcctctcagccagccctcccccaggatggggcacagact
ctccgcagggcctcgcctcactcctcaggggagtcggtggctgccttctcactctacccc
agagctgggggtggcagtgggagtagtgggggccttgggcctcctggaaggccatatggt
gccatcccaggccaacatgtcactttgcctcggaagacatcctcaggttctttgccaccc
ccactttctttgtttggggcaagagccgcctcttctggagggccccctctgactactgct
gcaccccagagggaacctggcgctaggtctgagccagtacgctccaaactgccgtctaat
ttatga

DBGET integrated database retrieval system