KEGG   Mus musculus (mouse): 331195Help
Entry
331195            CDS       T01002                                 

Gene name
A430089I19Rik, Gm16522
Definition
(RefSeq) RIKEN cDNA A430089I19 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FTH LRR_4
Motif
Other DBs
NCBI-GeneID: 331195
NCBI-ProteinID: NP_808581
MGI: 2683305
Ensembl: ENSMUSG00000094560
Vega: OTTMUSG00000055645
UniProt: Q8C9W1
Position
5; 5 E3
AA seq 407 aa AA seqDB search
MTVQTPSTLQNLALQALLRDEALALFCLEEVPFLLFPALFKEAFAGRLKKLMKAIVAAWT
FPCLPVGALMKSPNLETLQAVLDGIDMQLTRESHPRGKLQVLDLRNVHHAFWDIWAGAED
GSCSSESLNEKPTVVKVLRRYARRKQLKVVADLCLRPRRDETQAYFLKWAQQRKDSLHLC
CINMKIWAMPVDFVLEILNVFHPEHIEEFELNTEWNVFNLARFAPCLGQMRNLRKLLLAP
LYKNVFKIANRTGDREDKCVKEFVSIFSKFNCLQHLSMQGVHFLTDHMSQVFRCLMTPLE
SLSITHYQISQSDLDSFSCCQSLFQLKHLEMKGMVLQVLDVMPLRGLLEKVAKTLETLNL
QGCKLKDSQLNALLPSFIRCSQLTKINLYNNDFSMPILKDLLQQTAN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcagactccgtccactctccagaatctggcattgcaggctctgctgagagat
gaggctttggccttgttctgtctggaggaggtgccttttctgctcttcccagctctgttc
aaggaggcctttgctggcagacttaagaagctcatgaaggcaatcgtggcagcctggact
tttccctgtctccctgtgggggctttgatgaagtcacctaacttggagaccttgcaggct
gtgctagatggaatagacatgcaactgacaagagaatctcaccccaggggaaaacttcag
gttctggacctgaggaatgtgcaccatgccttctgggacatatgggctggtgcagaggat
ggtagctgttcttcagagtccttgaatgagaagcctacagtagtgaaggtccttcgcaga
tatgcacggaggaagcagctgaaagtggtagcagacctgtgcctcaggccccgccgtgat
gaaacacaagcatacttcttgaagtgggcccagcagagaaaggactccctacatttgtgc
tgtataaacatgaagatctgggctatgcccgtggactttgtcttagagattttgaatgtc
tttcatccagagcacatcgaggaattcgaactgaacactgagtggaatgtgtttaatctg
gcccgttttgctccctgcttagggcagatgagaaatcttcgcaaacttctcctggcaccc
ctctataagaatgtcttcaagattgccaataggacaggagacagagaagataagtgtgtc
aaggagttcgtttctatcttctccaaattcaattgtctccagcatctctccatgcaaggt
gtccactttctcacagaccacatgagtcaggtcttcaggtgcttgatgacacccttggag
tccctctccatcactcactaccaaatttcacagtcagacttggattccttctcttgctgt
cagagtctctttcagctaaaacatctggagatgaaaggcatggtcttacaggttttggat
gtgatgcctctgagaggtctcttagagaaagtggcaaaaactcttgagactctgaatttg
cagggatgtaagctgaaggactctcagctcaatgcactcctaccttccttcatacgatgc
tctcagctcaccaagatcaacttgtacaacaatgacttctccatgcccatcctgaaggac
cttttacagcaaacagccaactga

DBGET integrated database retrieval system