KEGG   Mus musculus (house mouse): 331374
Entry
331374            CDS       T01002                                 
Symbol
Dgkk, Gm360
Name
(RefSeq) diacylglycerol kinase kappa
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    331374 (Dgkk)
   00564 Glycerophospholipid metabolism
    331374 (Dgkk)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    331374 (Dgkk)
   04072 Phospholipase D signaling pathway
    331374 (Dgkk)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    331374 (Dgkk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     331374 (Dgkk)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 PH DUF2205 YegS_C
Other DBs
NCBI-GeneID: 331374
NCBI-ProteinID: NP_808582
MGI: 3580254
Ensembl: ENSMUSG00000062393
UniProt: Q6DIC8
Position
X:6691103..6814602
AA seq 1118 aa
MERAPESWPEPTPESCLRMSPALHLLQVVPGEKSGTASPVLLPLPSPKPPITWSRIKKIL
KEGPLLKNCNSFRRWKLRYCLVQGQKLHFAHHPSFAHFETIDLSQVVLAESSCRNLCHGF
CVITPHRKVSLVAPTRQDMEEWINIIKTVQQGEIRQIPAAENNPFLVGMHYWYSSSNPRS
HFCNVCRENIPALSRDAVTCEVCQVKSHKFCALRANKDCKWNTLSVTDDLLLPADEIQTM
PHQWVEGNIPAGSQCVVCHKSCGSHHRLQDFRCLWCGSTVHGACQKRFSKECSFGSRRSS
IVPPTALSDPRGDGQLVVSPDFWNLDWPLTCSCPLLIFINSKSGDHQGIIFLRKFKQYLN
PSQVFDLAKGGPEAGIAMFKNFARFRVLVCGGDGSVSWVLSTIDAYGLHDRCQLAIIPLG
TGNDLARVLGWGAVWSKGTSPLDILSRVEQAHVRILDRWSVMIRETPRQAPLLKGQVAMD
IPRFEAAAIKNVESATTELNKILKAKYPTEMVIATRFLCSAVEDFVEDIVKAWHQIKQNS
TAVESVILKSDLMYDKLSVLIDLLAEDAVAASAERTATAYGSRSQADGKPFVPQLDHIAR
AKLELAERAQKLQQSLKLIIFQVEQVLDEESRQSLSVKNFTSSLFLGDGDDDDSDDYDQS
PRHRSRCDILCSIPSLRNEDLDNLDLEHLHIAPETIRFKEKCVMNNYFGIGLDAKISLEF
NSRREEHPEQYNSRLKNKIWYGLLGSKELLQRSYRKLEERIHLECDGEAVSLPNLQGIVV
LNITSYAGGVNFWGRNRATTEYDVPAINDGKLEVVAIFGSVQMAMSRIVNLQQHRIAQCH
EVVITIDGEDGVPVQVDGEAWIQKPGLIKIKYKNVAQMLMRDRDFENSMKTWESKHTEIQ
AVQPPHLDFQESQDSLSDGEYAQMQHLARLAENLISRLTDLSKVHQHVSVLMDSVNASAN
ILNDVFYSQDSGNEAGAASCIPIETLSRTDAVDVTFSLKGLYDDTKAFLDENLLRDAEDR
AMLQTALDAMNTELRRILAIGWLSQIFFPEEQASDTRSLSRRFRIKFPKLGKKKQREEGE
KPKSSQRFPGFLGKFWRRRNRSNRAKADDPPTPSSSQL
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggagagggccccagagtcctggccagagccaactccagagtcctgtctaagaatgagt
ccagcactacatctgttgcaggtagttcctggagagaaaagtggaacagcatctccagtg
ctattgccattgccgtcgcccaaaccgccaataacgtggtccagaataaagaaaatactg
aaggaaggacccctgctgaagaactgtaactccttcagaagatggaagcttagatactgt
ctggttcaagggcagaagctccactttgcacaccatccttcgtttgcacactttgaaaca
attgatctgtctcaagttgttttggctgaaagtagctgcagaaatctttgccatggtttt
tgtgttatcacaccacatcgaaaagtgtctctagttgcacccactcggcaagacatggaa
gaatggattaacatcataaaaactgtccaacaaggagaaatccgtcagatccctgcagcc
gaaaacaacccctttcttgtcggaatgcactactggtattccagtagtaatccccggagt
cacttctgcaatgtttgtcgagagaacattcctgctttatctcgagatgccgtcacctgt
gaagtctgtcaggtgaaatctcataaattctgtgctttgagagcaaacaaagactgtaaa
tggaatactttatccgtgactgatgaccttcttctacccgctgatgaaatacaaacaatg
ccgcatcagtgggtagaaggaaatatacccgctggctctcaatgtgtcgtatgtcacaag
agctgcggtagtcatcacagacttcaggatttccgctgcctctggtgcggctctacggtg
cacggggcctgccagaagcggttttccaaggaatgttccttcggaagtcgtcgctcgtcc
atcgtgccaccaacggcactgagcgaccctaggggcgatggccagctagtagtatcgcct
gacttctggaatcttgactggccactgacttgttcctgtcccttgctcatcttcatcaac
tctaaaagtggagatcatcaagggatcatctttctccggaaattcaaacaataccttaat
ccgtctcaagtattcgacctggcgaagggtggacctgaagcaggcatcgctatgttcaag
aactttgcccgttttcgtgttctggtttgtggtggagatggcagtgtgagctgggtcttg
tctacgattgatgcctatggattgcatgataggtgtcagctggcgatcatcccacttgga
actggtaatgatctcgctcgtgtcctgggctggggagcagtctggagtaaaggcacatca
ccactggatattctcagcagagtggagcaggctcacgtgaggattttagacagatggagt
gtgatgatccgtgagacccccagacaagccccgctgctgaaaggacaagtggcaatggat
ataccaagatttgaggctgctgccatcaagaacgtagagtctgcaaccactgagttgaac
aaaattctgaaggccaaatatcccacggagatggtcatcgccacaagattcctgtgctca
gcagtggaagattttgtggaagatattgtaaaggcctggcaccaaataaaacagaacagc
acagcagtggagtctgtgattttgaaaagcgacttaatgtatgataaactcagtgtcctt
attgatctcctggctgaggatgcagtagctgcctccgctgagaggacagccacagcatat
ggaagcagaagccaagcagatggaaaacccttcgtgcctcaactagaccacatagcaagg
gccaaactggagttggctgaaagggctcagaaactccagcagtccttgaaactcatcata
ttccaggtcgaacaagttctggatgaagaaagcagacagagcttatcagttaagaacttt
acttcatctttgttcctgggagacggagacgacgacgactcagatgactatgatcagagc
cctagacaccgttctcgttgtgacatcttatgttctataccttctctgagaaatgaagac
ctagataaccttgacttagaacacttacacattgcacctgaaacgatacgcttcaaagaa
aagtgtgtcatgaacaactactttggaattggactagacgcaaaaatctctctggagttt
aattccagaagagaagaacatccagaacaatacaatagccgcctcaagaacaaaatatgg
tatggtcttctgggaagcaaggaattactgcaacgctcttacaggaaattggaagagcga
atacacctcgagtgtgatggagaagctgtctccttgccaaaccttcaaggcatcgtagtg
ctcaacattacgagctacgctggaggcgtcaacttttggggaagaaacagagcaaccaca
gaatatgatgtccctgcaatcaatgatgggaagctagaggttgtggcaatctttggttct
gtgcagatggccatgtctcgtatcgtcaacctgcaacaacatcgaattgcgcagtgccat
gaggtggtaataactattgatggtgaagacggtgtccctgtgcaagtggatggggaagcc
tggattcagaagccaggccttatcaagattaaatacaagaatgttgcccagatgttgatg
agagatagggactttgagaactcaatgaaaacctgggaatctaagcatactgaaatccaa
gctgtccaaccaccccacctggatttccaggaatctcaagacagcctctctgatggagag
tatgcccagatgcagcacttggctcggcttgcagaaaacctcattagcagacttactgac
ctaagcaaggtccaccagcacgtgtctgtcctcatggattctgtgaatgccagtgctaac
atactgaatgatgtgttctatagccaagacagtggtaacgaagcaggcgcagcttcctgc
attcccattgagactctaagcagaactgatgcagtagatgttacatttagtcttaaaggg
ctctacgatgacaccaaagctttcctggatgaaaacttgttgagagatgctgaggatcgg
gccatgctacaaactgccttggatgccatgaatacagagttaagaaggatactggcaatt
ggctggctgagtcaaatcttctttccagaggaacaggcttctgacactcgcagtttaagt
cgtaggtttagaataaaattccccaagctggggaagaagaaacaacgagaagagggagaa
aagcctaaatcaagccaaagattccctggttttcttggcaagttctggcgtcgaagaaat
cgtagcaatcgagcaaaagctgatgaccctccaacaccttcaagttctcaactatag

DBGET integrated database retrieval system