KEGG   Mus musculus (mouse): 331401
Entry
331401            CDS       T01002                                 

Gene name
Thoc2, 6330441O12Rik, D130005M13Rik, Gm1139, Gm1793, Tho2
Definition
(RefSeq) THO complex 2
  KO
K12879  THO complex subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    331401 (Thoc2)
  09122 Translation
   03013 Nucleocytoplasmic transport
    331401 (Thoc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    331401 (Thoc2)
   03041 Spliceosome [BR:mmu03041]
    331401 (Thoc2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     331401 (Thoc2)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   EJC/TREX
    331401 (Thoc2)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    331401 (Thoc2)
Motif
Pfam: Tho2 THOC2_N Thoc2
Other DBs
NCBI-GeneID: 331401
NCBI-ProteinID: NP_001028594
MGI: 2442413
Ensembl: ENSMUSG00000037475
Vega: OTTMUSG00000017445
UniProt: B1AZI6 Q8CCY8 Q3UUT9 Q3US09
Position
X; X A4
AA seq 1594 aa
MAAAAVVVPAEWIKNWEKSGRGEFLHLCRILSENKSHDSSTYRDFQQALYELSYHVIKGN
LKHEQASSVLNDISEFREDMPSILADVFCILDIETNCLEEKSKRDYFTQLVLACLYLVSD
TVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELG
QDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCE
PQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCIMDEYK
REIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKPPDNQKLGLLEALLKVGDWQH
AQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVGVPKGAKGSPVSALQNKRAPKQ
VESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEVIL
SCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNGHPLLVK
VKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDS
LKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGL
LQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIR
NTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQF
GGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGS
KQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYE
REVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEK
DNWLLAKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRV
FSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFD
GGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNL
GQALERRVNKICQEEKEKRPDLYALAMGYSGQLKSRKSHMIPENEFHHKDPPPRNAVASV
QNGPGGGTSSSSIGNASKSDESGAEETDKSRERSQCGTKAVNKASSTTPKGNSSNGNSGS
NSNKAVKENDKEKVKEKEKEKKEKTPATTPEARALGKDSKEKPKEERPNKEDKARETKER
TPKSDKEKEKFKKEEKAKDEKFKTTVPIVESKSTQEREREKEPSRERDVAKEMKSKENVK
GGEKTPVSGSLKSPVPRSDISEPDREQKRRKIDSHPSPSHSSTVKDSLIDLKDSSAKLYI
NHNPPPLSKSKEREMDKKDLDKSRERSREREKKDEKDRKERKRDHSNNDREVPPDITKRR
KEENGTMGVSKHKSESPCESQYPNEKDKEKNKSKSSGKEKSSSDSFKSEKMDKISSGGKK
ESRHDKEKIEKKEKRDSSGGKEEKKHHKSSDKHR
NT seq 4785 nt   +upstreamnt  +downstreamnt
atggcggccgcggctgtggtggttcccgcagagtggataaagaactgggagaaatcaggg
agaggcgaatttttacatttatgccggattctcagtgaaaataaaagccatgacagttcg
acctacagagattttcaacaagctctgtatgagttgtcataccatgtcattaaagggaat
ttaaagcacgaacaggcatctagtgttcttaatgacattagcgaattccgtgaggatatg
ccttctatccttgctgacgtgttctgcatattagatattgaaacaaattgtttagaagaa
aaaagcaagagagactattttacacagttggtattagcatgtttgtatttagtttcagac
acagttttgaaggaacgattggatccagaaactttggaatcattagggcttatcaaacag
tcacagcagttcaaccaaaagtcagttaaaatcaagacaaaactcttttataagcagcaa
aaattcaatttattaagagaagaaaatgaaggttatgccaagctgattgctgaactggga
caagatttatctggaaatattactagtgatttaatattagaaaatatcaaatctttaatc
ggatgctttaatctggatcctaatagagttttggatgtcattttagaagtgtttgaatgc
aggccagaacatgatgacttctttatatctttattagaatcttacatgagtatgtgtgag
ccacaaacactgtgtcatattcttggattcaaattcaagttttaccaggaaccaagtggt
gagacgccatcgtctttatacagagttgcagcagtcctcctgcaatttaatctcattgat
ctagatgatctttatgtgcatctccttcctgctgataattgtattatggatgaatacaaa
cgagaaattgtggaagctaagcaaattgtaagaaaactcacaatggttgtgctgtcttct
gaaaaacttgatgaacgagacaaagaaaaggacaaagatgatgagaaagttgagaagcca
ccggacaaccaaaagctgggtttgttggaagctttgttaaaagttggtgattggcagcat
gcacagaacatcatggatcagatgcctccatactatgcagcttcacataaactaatagct
cttgctatttgcaagctcattcacataaccgttgagcctctctaccgaagagttggtgtt
cctaaaggtgctaagggctcaccggttagcgctttgcaaaacaagagagcaccgaagcaa
gtagagagctttgaagatttgaggagggatgtattcaatatgttctgttaccttggtcct
cacctctcacatgatcccattttatttgcaaaagtcgtgcgcataggcaagtcatttatg
aaggagtttcagtctgatggaagcaaacaggaagataaagagaaaacggaagttatcctt
agctgtttgcttagcattactgaccaggtattacttccatctctttctttgatggactgc
aatgcttgcatgtctgaggagctgtggggaatgtttaagacatttccctatcagcataga
tatcgactatatggtcagtggaagaatgaaacttataatggtcacccacttttagtaaaa
gttaaagctcaaacaatagacagagccaagtatatcatgaagcgtctaaccaaggaaaat
gtgaagccttcaggaagacaaattggcaagctgagccacagcaatccaacaattttgttt
gattatatcttgtcacaaatccagaaatacgataacttaataacacctgtagtagattca
ttgaaatacctcacttcgttgaattatgatgtcttggcctattgtatcattgaagcttta
gctaatccagaaaaggaaagaatgaaacatgatgacacaaccatctcaagctggcttcag
agtctggctagtttctgtggtgcagtattccgtaaatacccgattgatcttgctggtctt
cttcagtatgtagccaatcaattaaaggcaggcaaaagttttgacctactaatattgaaa
gaagtggtacaaaaaatggcaggaattgaaattacagaggagatgacgatggagcagtta
gaagccatgactggtggggagcagctaaaggctgagggtggttatttcggccagatcaga
aacactaaaaaatcttctcagagattaaaggatgcactactggaccatgatcttgctctt
cctctctgtttgcttatggcacaacagagaaatggggtaatttttcaggagggtggagag
aaacacttgaaacttgtggggaaactctatgaccagtgtcatgacaccctagtacagttt
ggtggatttttagcatcaaatctaagtacagaagattatataaaacgagtgccttcaatt
gatgtgctctgtaatgagtttcatacaccacacgatgcagcattttttctgtctaggcca
atgtatgcacaccatatttcgtcaaaatacgatgaacttaaaaaatcagaaaagggaagt
aaacagcaacataaagtccataaatacattacatcatgtgagatggtgatggctcctgtc
catgaagcagtggtctccttacatgtttccaaagtctgggatgacatcagtcctcagttc
tatgctacattttggtcattgacaatgtatgaccttgcagttccacataccagctatgaa
agagaagtcaataaacttaaagtccagatgaaagcgattgatgacaatcaggaaatgcct
ccaaataaaaagaaaaaagaaaaggagcgttgcactgcccttcaggacaagctccttgaa
gaagaaaagaagcagatggaacatgttcaaagagtacttcagagactgaaactagaaaag
gacaactggcttttagcaaagtctaccaaaaatgagaccatcacaaaatttttacagctg
tgtatatttcctcgatgcattttttcagcaattgatgctgtttattgtgctcgttttgtt
gaattggtacatcaacagaaaactccaaatttttccacacttctttgctatgatcgagtt
ttttctgacataatttacacggttgcaagctgcactgaaaatgaagctagtcggtatggg
agatttctttgctgtatgttagagacggtgaccaggtggcatagtgatagagccacatat
gaaaaggaatgtggaaactatccaggattccttaccatattacgggcaactggatttgat
ggtggaaataaagctgatcagttagattatgaaaattttcgacacgttgtccacaaatgg
cattacaaactaaccaaggcatcagtacattgccttgagacgggcgaatatactcacatc
aggaatatattgattgtactaacaaaaatacttccttggtacccaaaagttttgaatctg
ggtcaggctttggagagaagagtgaataaaatatgccaagaagaaaaagagaagaggcca
gatctttatgcattggctatgggctactcggggcagttgaaaagtagaaagtcacacatg
atacctgaaaatgaatttcatcataaggatcctcctccaaggaatgctgttgccagtgta
caaaatgggcctggtggtgggacttcttcatcatctataggaaatgcatctaaatcagat
gaaagcggtgctgaggagactgataaatcaagggagagatctcagtgtggtacaaaagct
gttaataaggcttctagtaccacaccaaaggggaattcaagcaatggaaatagtggctct
aacagcaacaaagctgttaaggaaaatgacaaagaaaaagtaaaagagaaagaaaaagag
aaaaaggagaagactccagctacaactccagaggccagggcacttggtaaagatagtaaa
gaaaaaccgaaggaagagcggccaaataaagaagacaaagcaagagagacaaaggaaaga
acacctaaatctgacaaagagaaagagaagttcaagaaggaagaaaaagctaaagatgag
aaattcaagactaccgtccccatcgtagaatcaaaatcgactcaagaaagggaaagagag
aaggagccatccagagaaagagatgtagcaaaggaaatgaagtcaaaggaaaatgttaaa
ggaggagaaaaaacaccagtttcagggtccttgaagtcacctgttccccgatcagatatc
tcggagcctgacagggaacaaaaacgccgcaaaattgatagtcatccttctccatcacat
tcctccacagtaaaggacagtctcatcgatctcaaggactcttcagcaaagctctacatt
aaccataaccctccaccactgtccaagagtaaggagagagaaatggacaagaaagatttg
gacaagtcaagggaaagatccagagaaagagagaaaaaagatgaaaaggacaggaaagaa
cggaaaagggatcattcaaacaatgaccgcgaagtgccaccggacataacaaagaggcgg
aaagaggagaatggaacaatgggggtttcaaaacacaaaagtgagagtccatgtgagtct
caatatccaaatgagaaagacaaagagaaaaataagtcaaaatcttcaggcaaagaaaaa
agcagtagtgattcgtttaagtctgagaagatggataaaatctcatctggtggcaaaaag
gaatccaggcatgataaagaaaagatagaaaagaaagaaaaacgggatagttcaggagga
aaggaagagaagaaacatcataagtcctctgacaagcacagataa

DBGET integrated database retrieval system