KEGG   Mus musculus (mouse): 331416Help
Entry
331416            CDS       T01002                                 

Gene name
Gm773
Definition
(RefSeq) predicted gene 773
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Cor1 TCTP Baculo_PEP_C DUF4709 Sterile Pro_sub2 Exonuc_VII_L BshC RecG_N DUF1664
Motif
Other DBs
NCBI-GeneID: 331416
NCBI-ProteinID: NP_001028595
MGI: 2685619
Ensembl: ENSMUSG00000073177
Vega: OTTMUSG00000017498
UniProt: Q3TML4
Position
X; X A6
AA seq 206 aa AA seqDB search
MDNRKHFSVYNLDDGEEEDDVLEYSAHSTLTARSLVFSNTEKALVPTRMGGTDTRNEVKN
RMENIGAHLSSAVVEKKRRMESYIKDVVKDCDKHIKQHWKVHQDEVREFKIEYTEQIITL
FQQWDFDMKNVEDLEDNLTSAFCQQQKTFPQTTSRQVHSLKALKQANDTLLKGMENLDKD
NSSVLSSIHSEFKKQMAFLERKLTDG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggacaataggaagcacttctcagtctataaccttgatgatggtgaagaagaggatgat
gttctggagtattcagcacactctacacttacagcaagaagcctagtatttagtaatact
gagaaggcattggttcctacaagaatgggtggtacagatacaagaaatgaagtaaagaat
aggatggaaaacattggagctcaccttagcagtgctgttgttgaaaagaaaaggaggatg
gagtcatatattaaagatgttgtcaaagattgtgacaagcatatcaaacaacattggaaa
gttcatcaagatgaagtacgggagtttaaaattgaatatactgagcagattataactctg
tttcagcagtgggattttgatatgaagaatgttgaagaccttgaagataacctaactagt
gccttttgtcagcaacagaagacttttccacaaaccacatcacggcaggtccacagcctg
aaagcacttaagcaggcaaatgacacgctcttaaagggtatggagaacttggacaaagac
aatagcagtgtactttctagtattcacagtgagtttaaaaagcaaatggctttcctggaa
agaaaattgacagatggttaa

DBGET integrated database retrieval system