KEGG   Mus musculus (mouse): 331461Help
Entry
331461            CDS       T01002                                 

Gene name
Il1rapl1, 6330532G10Rik, C030039N24, IL1R8, IL1RAPL, IL1RAPL-1, MRX34, OPHN4, TIGIRR-2
Definition
(RefSeq) interleukin 1 receptor accessory protein-like 1
  KO
K05170  interleukin 1 receptor accessory protein-like
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    331461 (Il1rapl1)
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    331461 (Il1rapl1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    331461 (Il1rapl1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL1 receptor family
   331461 (Il1rapl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_6 Ig_2 Ig_3 I-set ig V-set TIR_2
Motif
Other DBs
NCBI-GeneID: 331461
NCBI-ProteinID: NP_001153875
MGI: 2687319
Ensembl: ENSMUSG00000052372
Vega: OTTMUSG00000016973
UniProt: B1ASU0 Q0VDP7
Structure
PDB: 

Position
X; X C1
AA seq 696 aa AA seqDB search
MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYI
RTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI
RNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEIL
WYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDK
PPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWE
SDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVEL
AGGLGAILLLLICSVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN
QETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPN
YVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWH
GPKCNKLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTAL
ATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQ
RPQTKSNREPNPDEAHTNSAILPLLPRETSISSVIW
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctccgatcccacatttgattctcttatatgctactttcactcagagtctgaag
gttgtgactaaaagaggttctgctgatggatgcacagattggtctgttgatatcaagaag
taccaagttttggtgggagaacctgttagaatcaagtgtgcactcttttatggttatata
agaacaaactactcgctcgcccaaagtgctggactcagcttaatgtggtataaaagctct
ggtccaggagattttgaagagcctatcgcctttgatggaagtagaatgagcaaagaggaa
gattccatttggttcagaccaacattactacaggacagtgggctttatgcctgtgtcatc
aggaattccacatactgtatgaaagtctccatctcactgacagtgggagaaaatgacact
ggactttgctacaattccaagatgaagtactttgaaaaagctgaacttagcaaaagcaag
gaaatttcatgccgagacatagaggactttttattaccaaccagggaacctgaaatcctt
tggtacaaggaatgtagaacaaaagcatggagaccaagtattgtcttcaaaagagatacc
ttgcttataaaagaagtcaaagaagatgacattggaaactatacctgtgaattaaaatac
ggaggctttgttgtgagaagaacgactgagttaactgttacagctcctctaactgataag
ccacctaagcttttgtatcccatggaaagtaaactgacagttcaggagactcaactaggt
ggctcagccaacctcacctgcagagctttctttgggtacagtggagatgtcagtccttta
atttactggatgaaaggagagaaatttattgaagatctggatgaaaatagagtttgggaa
agtgacattagaatccttaaggaacatcttggagaacaggaagtttctatttcattaatt
gttgactccgtggaagaaggtgacctggggaactattcctgttatgttgaaaatggaaac
ggacgtcggcatgccagtgttctccttcataaacgagagttaatgtacaccgttgaactt
gctggagggcttggcgctattctcttgctgctcatctgttcggtgaccatatataaatgt
tacaagatagaaatcatgctcttctacaggaatcattttggagctgaggaactggatgga
gataacaaagattatgatgcctatctgtcatataccaaagtggatcctgaccagtggaat
caagagactggggaagaagaacgttttgcccttgaaatcctccctgatatgcttgaaaag
cattatggatataagttgtttataccagatagagatctgatcccaactggaacatacatt
gaagatgtggctagatgcgtagatcaaagtaagcggctgattattgtcatgaccccaaat
tatgtagttcgaaggggctggagcatctttgagctggaaacgagacttcgaaacatgctt
gtgactggagaaattaaagtgatactgattgaatgcagcgaactccgaggaattatgaac
taccaggaggtggaggccctcaagcataccatcaagcttctgacggttattaaatggcat
ggaccaaaatgcaacaagttgaactcgaagttctggaaacgtttacagtacgaaatgcct
tttaagaggatagaacccattacacatgagcaggctttagatgtcagtgagcaggggcct
tttggggagctgcagactgtctcggccatttcaatggctgcagccacctccacagctcta
gccactgcccatccagatctccgttctacctttcataacacctaccattcacaaatgcgt
cagaaacactactatcgaagctatgagtacgacgtacctcctacgggcaccctgccactt
acctccataggaaatcagcatacctactgtaacatccctatgacactcatcaatgggcag
cggccacagacaaagtcgaacagggagccgaatccagacgaagcccacacaaacagtgcc
atcctgccgttgttgccaagggagaccagtatatccagtgtgatctggtga

DBGET integrated database retrieval system