KEGG   Mus musculus (mouse): 331493
Entry
331493            CDS       T01002                                 

Gene name
Gm5127, B130007I08, EG331493
Definition
(RefSeq) predicted gene 5127
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 331493
NCBI-ProteinID: NP_001028713
MGI: 3648285
Ensembl: ENSMUSG00000073010
Vega: OTTMUSG00000018270
UniProt: Q3UQH6
Position
X; X D
AA seq 212 aa
MKDLRRYLMFKYIQYLVLPSPNVIIILLGSLASLYVMLLLTFPSVSRKSTAVFIGSIAQA
DILVVCSLFSAISACVIRSEPSSTSFQLALRQNFQIANIHASSLLLSCVTLEAFLITFLP
VETRHIRNVRCARVASKIIWAVVITECFLYQLEYVKGLNISYLGIHRQIQLLMNFFYEAT
VLLKLLIYPIGVLLRIFNVYLFYKMYFRDHYS
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaaagacctccgcaggtacctgatgttcaaatacatccagtatctagtcctgccttct
ccgaatgtcatcatcattctgctgggatctcttgccagtctctatgtcatgctgctattg
acatttccttccgtttccagaaaatccactgcggtgtttattggtagcatagctcaggca
gacatcttagttgtctgcagcttgttttctgctatctcagcatgcgtgataaggagcgag
ccatcgtcaacttcttttcaactagccttgaggcaaaacttccaaattgcaaatatccat
gccagttcccttttactcagctgtgttacccttgaggcttttctgattacttttcttcca
gtagagacacgccacataaggaatgttagatgtgccagagtggcttctaaaatcatctgg
gctgttgtaattaccgagtgtttcctttatcagcttgaatatgtcaaaggccttaacatc
tcctatcttggcattcataggcaaattcagctattgatgaatttcttttatgaggccaca
gtgctgctgaaattacttatttatcccattggagttcttctaagaatcttcaacgtatat
cttttttataaaatgtatttccgagaccattatagttag

DBGET integrated database retrieval system