KEGG   Mus musculus (mouse): 332397
Entry
332397            CDS       T01002                                 

Symbol
Nanos1, NOS-1
Name
(RefSeq) nanos C2HC-type zinc finger 1
  KO
K18741  protein nanos 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    332397 (Nanos1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     332397 (Nanos1)
SSDB
Motif
Pfam: zf-nanos
Other DBs
NCBI-GeneID: 332397
NCBI-ProteinID: NP_848508
MGI: 2669254
Ensembl: ENSMUSG00000072437
UniProt: Q80WY3
Position
19; 19 D3
AA seq 267 aa
MEAFPWAPRSPRRARAPAPMALVPSARYVSASGPVHPQPFSSWNDYLGLATLITRASDRG
SPHEGPGPTAAGPTMGPPEDDEDDDGEEPEAGGRYLGGALELRALELCAGPAEPGLLEER
FAELNPFAGRAAAVLLGCAPTASTTAAAASTAEVTPREEPSPAWAAEPRLHAASGATAAR
LLKPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYC
PLSKVPPPTVRPPPRSNRDSLPSKKLR
NT seq 804 nt   +upstreamnt  +downstreamnt
atggaggctttcccttgggcgccacgctcgccccgccgcgcccgcgcccccgcgcctatg
gcgctcgtgcccagcgcccgctacgtgagcgcctcgggcccggtgcacccgcagcccttc
agctcctggaacgactacctggggcttgccacgctcatcaccagggctagcgaccgcggc
tccccgcatgaggggcccgggcccacggcggcggggcccacgatggggccgcccgaggac
gatgaagacgatgacggcgaagagccggaggccgggggccgctacctgggcggtgcgttg
gaactgcgcgcactagagctgtgtgccggccccgctgagcccgggttgctggaggagcgc
ttcgctgagctgaacccgtttgcagggcgcgccgccgcggttctgctgggctgcgcgccc
accgcctccaccaccgccgccgccgcatccacggccgaagtgacgccgcgcgaagagcca
agccctgcgtgggctgccgagcctcgtctgcacgcggcttccggggcgaccgccgcacgt
ctgctgaaaccggagcttcaggtgtgtgtgttttgccggaacaacaaggaggcggtggcg
ctctacaccacacacatcctcaagggcccggacggccgggtgctgtgcccggtcttgcgc
cgctacacgtgccccctgtgcggcgccagcggcgacaacgcacataccatcaagtattgc
ccgctctccaaagtgccaccgcccaccgtccgcccgccgccgcgcagcaacagggacagc
ctgcccagcaagaagctgcgctag

DBGET integrated database retrieval system