KEGG   Mus musculus (mouse): 333670Help
Entry
333670            CDS       T01002                                 

Gene name
Gm867, Gm736
Definition
(RefSeq) predicted gene 867
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Il2rg
Motif
Other DBs
NCBI-GeneID: 333670
NCBI-ProteinID: NP_001264061
MGI: 2685713
Ensembl: ENSMUSG00000050157
UniProt: A0A1W2P7T4
Position
10; 10 C1
AA seq 151 aa AA seqDB search
MFITVMFGAGCRELVNPWCNLLNFTVHLKQKARVPPGGTIALLAEDGHLVKLEEETTQAP
SMACSLIQEQVTYVLVQVIKGKDGTPTHYESLLDNLDDQYPELAEELCCLSGFPTTSNSQ
RRRTGIRRGHREQGPPPSRSRRVTSLSSRNR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcactgtgatgtttggagcgggttgccgggagctggtgaacccctggtgcaac
ctgctgaacttcacggtgcatctgaaacagaaagctcgggttcccccaggaggaaccatt
gccctcctggctgaagatgggcacttggtgaagttagaagaggagaccactcaggcccca
tccatggcctgttccctgatacaggaacaagtgacctatgtcctggtacaggtcattaaa
gggaaagatgggacccctactcactatgagtcactcctggacaacctggatgaccagtat
ccagagttagcagaggagctgtgctgcctctctggctttccaaccacaagcaatagtcag
agaagacgcacgggcattcgacgtggccaccgggaacaaggtcccccaccttcaaggtct
cgaagggtgacctccctatcatctagaaaccgctaa

DBGET integrated database retrieval system