KEGG   Mus musculus (mouse): 338348Help
Entry
338348            CDS       T01002                                 

Gene name
Ttc16, 1200002K10Rik
Definition
(RefSeq) tetratricopeptide repeat domain 16
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_16 TPR_12 TPR_8 TPR_9 TPR_19 TPR_7 ANAPC3 TPR_15
Motif
Other DBs
NCBI-GeneID: 338348
NCBI-ProteinID: NP_001277493
MGI: 2443048
Ensembl: ENSMUSG00000039021
Vega: OTTMUSG00000012528
UniProt: Q8C1F5 Q3V0B6
Position
2; 2 B
AA seq 767 aa AA seqDB search
MTDPTKRRMIGSTVPAKVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAE
AFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQAS
DLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLC
YQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPL
DPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVTDTQDNLVKQAQRQLLLTYNDFAVHCYN
HGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL
RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDV
ATVLLLNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIENGPKNIYPQSTVV
QRLLERRKAQVLVKLWKQERLGTPEEEVTLYQAPQLAEEKKVKTARRRTSLTDSYADQTS
SGSVFSIVSISTSGPEMSTSQEYKSSSHTAIESSESTLLKPQLSVPRKSQELTWSPKVVQ
AVTENLIQNATEVTPAYGQRDSKKATQVPKPKKTEDPKDPSQSTSTTEAPEGPRPSKSRS
TLSVKERIRRAKAVRAQGWKLKAQRSSQKVTKTPSLTHSTTHSDIGESANDTPGQTPWPS
KAADSLSFSEISSTDLSSSESFLELTNLLTQEVQQIPGDREKLTSDD
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcctacaaaacgaaggatgataggatcaacagtgcctgccaaagtcagagag
tactataaccaaggccatcagtgcctcctacaagaggactgggagatgtctgtgctgttc
ttctcccgtgccctccacctggaccccaaactggtagacttctatgtattccgtgctgag
gccttcatccaactctgtgacttctcctctgccctccagaacctccgcagggcctactcc
tatgacccagggaataacaagtacctgaaccggctggcctttgtgctctacctacagggt
cagtgcctgtatgagctgtgtgacttccaggaagccctctgtgtcttcctgcaagcctcc
gacctccagccccaaaacgcttccttcagttaccgatgcatggcctgcctgctggccctc
aagcggtatcacgactgcctcgccctcatcactagggaggtgaagcagggcagggccagc
gctgatgtctacatcctccgggctcggctctacaacttcttccagaaggccaagctctgc
tatcaggaccttcgaagcgccttgctcctagatcccttgcacgcacaggccaaagggcta
ctccagaagatggtggaccaggccaagcagtctctccaagatgccagcaccctggccgtg
cagggcaaggtgcaccgtgcactgaagtgcatcaactgtgccattgagaacaatcccctg
gatcccaacttcttcttcttccggggcaccttgcgtagacggctccagcaatttgaccat
gctgtggaagacttcctgaaggcaatggacatggtgactgacacccaggacaacctagtg
aagcaggcgcagcgtcagctgctgctgacttacaatgactttgctgtgcactgctacaac
catggtgcctatcaggagggcgtgctgctgctgaacaaggctatcagagacgagcagaat
gagaagggcttgtacatcaaccgtggggattgcttcttccagctgggcaacctggccttc
gcggaggctgactacaagcaagcgctggccctgagcccgctggatgaaggagccaacttg
cgcatgggtgtgctgcaggagaagctgggcttctgccagcagaaacacaggcagttccag
acagcagaggagcacttctcggaggccataaggcacagccctcagaaaccacagtactac
ctgcaccgggccaagtgccgacagttcctgcagaacactctgggggcccgcctggatgtc
gctactgtactgcttctcaatcccgagtatcccaagatggctgcagtgatgaacaccctc
tttcctagcatgactgtggagaatgtgcttaagtcccaagtggccgaactggccaagctc
cagctaagtcggatgatagaaaatgggccgaagaacatctaccctcagagcactgtggtg
cagcggttattggaacgcaggaaagcccaagtcctggtgaagctctggaagcaggaacgt
cttgggacccctgaagaggaagtgactctttaccaggctccgcagctggcagaggaaaaa
aaggtgaaaaccgctcgcagaaggacatccctgacagacagctatgcggaccagacctcc
tcaggctccgtctttagcattgtgagcatcagcacgtcggggccagagatgtcaaccagt
caggagtataagagctcttcccacacggctatagaatcctctgagtccacactgctaaag
cctcagctctcagtacccaggaagagccaggaactgacctggagccccaaggtcgtccag
gcagtcacagagaacctaatccagaacgccactgaggtcacacctgcctatggccaaagg
gactccaaaaaggccacccaagtcccaaagcccaagaagacagaggatcccaaggatcct
agccagagcaccagcacgacagaagcccctgagggcccaaggcctagcaagtccaggtct
accctgagcgtaaaggagagaatcagaagagctaaggctgttcgcgcccagggctggaaa
ctcaaggcccagcgcagcagccagaaagtaacaaagactcccagcctgacccacagcacg
acccatagtgacattggtgagagtgccaatgataccccgggccagactccatggcccagc
aaggctgctgatagcttaagcttcagtgagatctcgtcaacagatctcagcagtagtgaa
agcttcttggaactgactaaccttttaactcaggaagtccaacagatcccaggagacaga
gagaagctcacctctgacgattaa

DBGET integrated database retrieval system