KEGG   Mus musculus (mouse): 338367
Entry
338367            CDS       T01002                                 

Gene name
Myo1d, 9930104H07Rik, AW544947, D11Ertd9, D11Ertd9e, myosin-1d
Definition
(RefSeq) myosin ID
  KO
K10356  myosin I
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    338367 (Myo1d)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    338367 (Myo1d)
   03036 Chromosome and associated proteins [BR:mmu03036]
    338367 (Myo1d)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    338367 (Myo1d)
   04147 Exosome [BR:mmu04147]
    338367 (Myo1d)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     338367 (Myo1d)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Others
    338367 (Myo1d)
 Others
  Actin-binding proteins
   Myosins
    338367 (Myo1d)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    338367 (Myo1d)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     338367 (Myo1d)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   338367 (Myo1d)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ Sigma54_activat Zeta_toxin AAA_22 AAA_18 AAA_16
Other DBs
NCBI-GeneID: 338367
NCBI-ProteinID: NP_796364
MGI: 107728
Ensembl: ENSMUSG00000035441
Vega: OTTMUSG00000000216
UniProt: Q5SYD0 Q3UG58
Position
11 B5; 11 47.95 cM
AA seq 1006 aa
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKVLNIYGR
DTVEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIMISGESGAGKTEASKYIMQYIA
AITNPSQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGH
INNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLHSLHLQKSLSSYNYIRVGAQLKSS
INDAAEFKVVADAMKVIGFKPEEIQTVYKILAVILHLGNLKFIVDGDTPLIENGKVVSVI
AELLSTKADMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRIN
DIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDGMFLEALNSKLG
KHGHFSSRKTCASDKILEFDRDFRIRHYAGDVVYSAIGFIDKNKDTLFQDFKRLMYNSSN
PVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQI
FDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVK
KLIERCGFQDDVAYGKSKIFIRTPRTLFTLEELRAQMLVRVVLFLQKVWRGTLARMRYKR
TKAALTIIRYYRRYKVKSYIHEVARRFHGVKNMRDYGKHVKWPTPPKVLRRFEEALQSIF
NRWRASQLIKTIPASDLPQVRAKVAAMEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIP
LYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHL
QVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggcggagcaggagagccttgagttcggcaaggcggacttcgtgctgatggacaccgtc
tccatgcccgagttcatggccaaccttaggctcagatttgagaaaggacgcatctacaca
ttcatcggagaagtggttgtttctgtgaatccatacaaggtgctgaacatctatgggagg
gacactgtcgagcagtataaaggtcgtgagctttatgagagacctcctcatctctttgct
attgctgacgctgcttacaaggccatgaagaggcgatcaaaagacacctgtattatgata
tcaggggaaagtggagctggtaaaacagaggccagtaagtacatcatgcagtatatcgcc
gccatcaccaaccccagccagagagcagagatagaaagagtgaagaatatgttgctgaag
tcaaactgcgttttggaagcttttggaaatgccaaaaccaatcgtaatgacaattccagc
aggtttgggaaatacatggatatcaactttgacttcaagggagaccccattgggggacat
attaataactacttgctggaaaagtctcgtgtgattgtgcagcagcctggagaacggagc
ttccattctttctatcagctcctccagggaggttctgagcagatgctgcactctcttcac
ctgcagaagtcactctcatcctacaactacatccgtgtgggggcacagctgaagtcttcc
atcaatgacgctgctgagttcaaagttgtagctgatgccatgaaagtaattggattcaaa
cctgaggagattcaaactgtgtataaaattttggctgttattcttcacttgggaaattta
aaatttatagtagatggtgacacgccgcttattgagaatggcaaggttgtgtctgtcata
gcagaattgctgtctactaaggcagacatggtggagaaagccctgctttaccggacggtg
gccacaggccgtgacatcatcgacaaacagcacacggaacaggaggccagctacggcaga
gacgcctttgccaaggcaatatatgagcgcctcttttgttggattgttactcgcatcaat
gacatcatcgaggtcaagaactatgacaccacgatacatgggaaaaacacggttattggt
gtcttggatatctatggctttgaaatctttgacaacaacagctttgagcagttctgcatt
aactactgcaacgagaaactgcagcagctcttcattcagctggtgctgaagcaggagcaa
gaggagtaccagcgggagggcatcccttggaaacacattgattacttcaacaaccagatc
attgtggacctcgtggagcagcagcacaaaggcatcattgcaatcctggatgacgcgtgt
atgaatgttggcaaagtcactgacggaatgttccttgaggcccttaacagtaaattgggc
aaacatggtcatttttccagccgaaagacctgtgcctcagacaaaatcctggagtttgat
cgggactttcgaatccgtcattatgcgggtgacgtggtctattctgccatcggttttatc
gacaaaaataaagatactttatttcaagatttcaagcgccttatgtataacagctcaaat
cctgtgctgaagaatatgtggcccgaaggcaagctcagcattacagaggtgaccaagagg
cctctgaccgctgccaccttgtttaagaattctatgattgctttagtagacaaccttgct
tcaaaggagccgtactatgtgcgttgcatcaaacccaatgacaagaagtccccacagata
tttgacgatgagcgctgccgccatcaggtagaatacctggggctgctggagaatgtgaga
gtgcgccgggcagggtttgccttccgccagacctacgagaagtttcttcacaggtacaag
atgatctctgagttcacctggcctaaccatgaccttccttcagacaaagaggctgtcaag
aaactcatagagcgatgtggctttcaggatgacgtagcttatgggaagagcaaaattttc
attcgaacaccccgtacactgttcaccctggaagaacttcgtgcccagatgctcgtcagg
gttgtcctcttcctacaaaaggtgtggcgtggcaccctggcccgcatgcggtacaagagg
accaaggcagctctgacaataatcaggtactacaggcgctataaagtgaagtcgtacatc
cacgaggtggccagacgattccacggtgtcaagaacatgagggactatgggaagcatgtg
aagtggccaaccccaccaaaagtcctgcggcgtttcgaggaggccctgcagtcgattttt
aatagatggagagcatcccaactcatcaagaccatacctgcatcagaccttccccaggtc
agggcaaaggttgcagccatggagatgctgaaaggtcaaagggcagaccttggactccag
agagcctgggaaggcaactatcttgcttcgaagccagacacacctcagacctcaggcact
ttcgtcccagttgctaatgagctgaaacgcaaggacaagtatatgaacgttctcttttcc
tgtcacgtccggaaggtgaatcggtttagtaaggtagaagaccgagcaatttttgtcact
gaccgtcacctgtataaaatggaccccactaagcagtacaaggtgatgaagactatccca
ctgtacaacttgactggtctgagtgtctccaatggaaaggaccaacttgtagtgttccat
acaaaagacaacaaagacctcattgtctgcctcttcagcaaacagccaacccatgagagt
cgtattggagaacttgttggagtcctggtgaatcatttcaagagtgagaagcgccacctt
caagtgaacgtcaccaacccggtgcagtgcagcctgcacgggaagaaatgcaccgtctct
gtggagacccggctcaatcagccacagcctgacttcaccaagaaccgctcgggcttcatc
ctcagtgtgcccgggaactga

DBGET integrated database retrieval system