KEGG   Mus musculus (mouse): 338368
Entry
338368            CDS       T01002                                 

Symbol
Pheta2, C920005C14Rik, Fam109b, IPIP27B, Ses2
Name
(RefSeq) PH domain containing endocytic trafficking adaptor 2
  KO
K23791  sesquipedalian
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    338368 (Pheta2)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   Others
    338368 (Pheta2)
SSDB
Motif
Pfam: PH
Other DBs
NCBI-GeneID: 338368
NCBI-ProteinID: NP_796365
MGI: 2443609
Ensembl: ENSMUSG00000049687
Vega: OTTMUSG00000034181
UniProt: Q14B98 A0A0R4J1Z2
Position
15:82223148..82229911
AA seq 259 aa
MKLNKRSVAHYALSDSPADHTGFLRSWGGPGSPPTPSGTGRRYWFVLKGNLLFSFETRES
RVPLSLVVLEGCTVELAEAPVPEEFAFAIRFDAPGVRPHLLAADGQAAQEAWVKALSRAS
FGYMRLVVRELESQLQDARQSLALHRCASQRAVANCSKSQAPDHRAPDPENGHFLPRDRS
SIGTVEERGIRPIGRDLTEWELQGPASLLLSMGQSPVSPESSCFSTLHDWYGKEIMELRR
GWQQRAKGSQTENKSQNRP
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaagctgaacaagaggagtgtggcccactatgcgctgagtgattctccggcagaccac
actggctttctgcgtagttggggaggaccaggttccccacccactcccagtggcactggc
cgaagatactggtttgttctcaagggcaatctgctattctctttcgagactagagagagc
cgggtcccgctgagtcttgtggtattggaaggctgcacggtggagctggccgaggctcct
gtacccgaggagttcgccttcgctattcgctttgatgcccctggagtgcgcccacacctg
ctggcagcagatgggcaggctgcccaagaggcatgggtgaaggcactgtcccgagccagc
tttggctacatgcgacttgtggtgcgagaattggagagccagttgcaggatgcccgtcag
agcctggccttgcatcgctgtgcatcccagagggctgttgccaattgtagtaaatctcag
gctcctgaccaccgagctccagaccctgagaacggccactttctccccagggaccgcagt
tccattggtactgtggaagaaagggggatccggccaataggtcgggatttgaccgagtgg
gagttacagggccctgctagcctcctcctaagcatgggacagagccccgtgtcccctgag
agctcctgtttctctaccctgcatgactggtatgggaaggagatcatggagctgaggcga
gggtggcagcaaagggcaaaaggaagccagacagagaacaagtcacagaataggccctga

DBGET integrated database retrieval system