KEGG   Mus musculus (mouse): 338371
Entry
338371            CDS       T01002                                 

Gene name
Endov, A730011L01Rik
Definition
(RefSeq) endonuclease V
  KO
K21813  endonuclease V [EC:3.1.26.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    338371 (Endov)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     338371 (Endov)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    338371 (Endov)
SSDB
Motif
Pfam: Endonuclease_5 UvrC_HhH_N MotA_ExbB DUF99
Other DBs
NCBI-GeneID: 338371
NCBI-ProteinID: NP_001158108
MGI: 2444688
Ensembl: ENSMUSG00000039850
Vega: OTTMUSG00000003953
UniProt: Q8C9A2
Structure
PDB: 

Position
11; 11 E2
AA seq 338 aa
MAHTAAERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDS
VRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMP
QVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGG
DTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQAD
IRSREYIRRTLGQLGVAPAQRKDRSQKEQRPNACPQGGPGALADQGRPPECDGRDSSSDR
KAPEPGFQEQKDQQLEGTGHQEDSDLWPPSPAWVQSPP
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctcacacggccgctgagcggccgccagaggaaaccctgtcgctgtggaaaggggaa
caagcccggctgaaagcgcgcgtggtggatcgggacacggaggcctggcagcgggacccc
agcttctcgggcctgcagaaggtcgggggcgtggatgtgtccttcgtgaaaggggacagt
gtccgggcctgcgcttccctggtagtgctgagctaccccgagctcaaggtggtgtatgag
gacagccgcatggttggcctgaaggccccctatgtgtcaggcttcctggccttccgagag
gtccctttcctggtggagttggtacagcggctgcaagagaaggaaccagatctcatgccc
caggtcgttcttgtggatggaaacggggtgcttcaccaacgaggcttcggggtggcctgc
caccttggtgtccttacagagctgccatgcatcggggtggccaagaagctcctgcaggtg
gatggactggagaacaatgctctgcacaaggagaagattgtgctcctgcaggccggagga
gacacatttcctctgataggcagctctgggactgtcctgggaatggccctgaggagccat
gaccacagcaccaagcccctctatgtctctgtgggccacagaataagcctggaggtcgct
gtgcgcctcacccaccactgctgtaggttccggatcccagaacctatacgccaggctgac
atccgctctcgagagtacatccgaaggactctagggcagcttggggtggctcctgcacag
agaaaggacaggagccagaaagagcagaggccaaatgcatgcccccaaggaggcccagga
gcacttgcagatcaaggcaggcctcctgaatgcgacggcagagactccagctcagaccgg
aaagcccccgagccaggcttccaggagcagaaggaccagcagttggagggaaccgggcat
caggaagactcggacctctggcctccttctccagcctgggtacagtcaccaccctga

DBGET integrated database retrieval system