KEGG   Mus musculus (mouse): 338374Help
Entry
338374            CDS       T01002                                 

Gene name
Ifnl3, IFL-1, IL-28B, INF-alpha, INF-lambda, Il28, Il28b
Definition
(RefSeq) interferon lambda 3
  KO
K22669  interferon lambda 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    338374 (Ifnl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    338374 (Ifnl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    338374 (Ifnl3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   338374 (Ifnl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL28A NUDIX_4
Motif
Other DBs
NCBI-GeneID: 338374
NCBI-ProteinID: NP_796370
MGI: 2450574
Ensembl: ENSMUSG00000060747
Vega: OTTMUSG00000059060
UniProt: Q8CGK6
Position
7; 7 B1
AA seq 193 aa AA seqDB search
MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEK
RLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLH
TLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLL
RDLKCVASGDQCV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcctgctgttgcctctgctgctggccgcagtgctgacaagaacccaagctgac
cctgtccccagggccaccaggctcccagtggaagcaaaggattgccacattgctcagttc
aagtctctgtccccaaaagagctgcaggccttcaaaaaggccaagggtgccatcgagaag
aggctgcttgagaaggacatgaggtgcagttcccacctcatctccagggcctgggacctg
aagcagctgcaggtccaagagcgccccaaggccttgcaggctgaggtggccctgaccctg
aaggtctgggagaacataaatgactcagccctgaccaccatcctgggccagcctcttcat
acactgagccacattcactcccagctgcagacctgtacacagcttcaggccacagcagag
cccaagcccccgagtcgccgcctctcccgctggctgcacaggctccaggaggcccagagc
aaggagactcctggctgcctggaggactctgtcacctccaacctgtttcaactgctcctc
cgggacctcaagtgtgtggccagtggagaccagtgtgtctga

DBGET integrated database retrieval system