KEGG   Mus musculus (mouse): 338375
Entry
338375            CDS       T01002                                 

Gene name
Atp6v1g3
Definition
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit G3
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    338375 (Atp6v1g3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    338375 (Atp6v1g3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    338375 (Atp6v1g3)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    338375 (Atp6v1g3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    338375 (Atp6v1g3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    338375 (Atp6v1g3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    338375 (Atp6v1g3)
SSDB
Motif
Pfam: V-ATPase_G RNase_Y_N Vps5 CemA Muted OmpH
Other DBs
NCBI-GeneID: 338375
NCBI-ProteinID: NP_796371
MGI: 2450548
Ensembl: ENSMUSG00000026394
Vega: OTTMUSG00000026869
UniProt: Q8BMC1
Position
1; 1 E4
AA seq 118 aa
MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQA
KIMGSQSHLSDEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRATN
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaccagccagtctcaggggatccaacagctcctgcaggcagagaaaagggccaaggac
aagctagatgaggcaaagaaaagaaaaggaaagcgactgaggcaagctaaggaagaagct
gtggcggagacggaccagtacagaatgcagatggagaaggacttccgcctgaagcaggct
aagataatgggctctcagagccacctctcggatgaaatagaagagcagacactagagaag
atcaaagaattgaacggaagctacaacaagtgtatggaaagcgtgattaagcagctattg
agcatggtgtgcgacatgaaaccagaagtccatgtgaactacagagccaccaactga

DBGET integrated database retrieval system