KEGG   Mus musculus (mouse): 347710Help
Entry
347710            CDS       T01002                                 

Gene name
Pramel4, C79430, D4Ertd792e
Definition
(RefSeq) preferentially expressed antigen in melanoma like 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4
Motif
Other DBs
NCBI-GeneID: 347710
NCBI-ProteinID: NP_001001319
MGI: 2156377
Ensembl: ENSMUSG00000073724
Vega: OTTMUSG00000010440
UniProt: Q3ULC4
Position
4 E1; 4 77.98 cM
AA seq 500 aa AA seqDB search
MSFKDPPTLQQLARRSLLKDEALTISALPNLPVQLFPPLFKDAFTSRQRKILSLMVATWP
FPVLPVGALCGIDHLETLKAVLDGLDLLMSQKDRPSRWNLQVLDLRDAHQDFWDGWAGLL
HEVCSQDVFGKNQPVGNHPIPGGKQTISIKMNLSLKYCRRHSHCENLNYLYYWAKQRKDV
IQVIFEKLEFTGKHCLRLKLWRLLKLSFVASIQELTIKSIHWDIYNLALIASCLGQMKNL
QKLILMNIRRPSSLTDLQEARIITEIFSEFSKLHKLQHLYVNDVYFLKERLDLMLRCFER
PLETLTITYCKLSESDMRYLSQCPSIHQLKYLDMSYTTFKPSSHRFLGFLGSLLERLTAT
LQTLKLECFHLTDSRIRDLLPGLSQCSQLTEVDFVENKFSMVSLKTLLQHTANLTQLTLE
KYPAPDEVYDDSLCVIPDRFVQLCSELMNTLKGVRQPKQVYFESTIYSPNFEYLVYNLEG
MVSSEPLRRRGRGMVIYISG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaggacccaccaacactccagcagctggcaagaagaagcctgctaaaagat
gaagccttgactatctctgctctgccgaacctgcctgtgcaactcttcccaccactcttc
aaggatgcattcaccagcagacaacgtaagatcctgagcctgatggtggcaacatggccc
ttcccagtccttcctgtgggagctctgtgtgggattgatcacctggagaccctgaaagct
gtactagatggccttgatttgctgatgtcacaaaaggatcgacctagcaggtggaaccta
caagtgcttgatttgcgagatgcccaccaggacttctgggatggttgggctggactactt
catgaagtctgctctcaagatgtctttggcaagaaccaaccagtgggaaatcatcccatc
ccaggggggaaacagaccataagtataaaaatgaatctttccctcaagtactgccgacga
cactctcattgtgaaaacctaaactatttgtattattgggccaagcagagaaaagatgtg
atacaggtgatctttgagaagctggagtttacaggcaagcactgtctccgactgaagttg
tggcggttgttgaagttgtcttttgtagcctcaatccaggaattgacaataaagtccata
cactgggatatatataaccttgcattgatagcctcttgcctgggccagatgaaaaacctc
cagaaactcattctcatgaacatcaggagaccttcttcccttacggacctacaggaagcc
cgtattattacagagatcttttccgagttctccaaactgcataagctccagcatctctat
gtgaatgatgtctacttcctgaaagaacgcctggacctaatgctcaggtgttttgagcgt
ccattagagacccttactatcacttattgcaagctttcagaatcagacatgaggtatctg
tcccagtgtccaagcatccatcagctcaaatacctggacatgagttacaccacattcaag
ccttcaagtcatcgatttctaggatttctcggaagcctactagaaagactgacagctact
ctgcagacattaaaattggagtgctttcacctcacggactcccgaatccgtgaccttctg
cctgggctgagccagtgttcccagctcactgaagtcgattttgtggagaacaaattttcc
atggtcagcctgaaaacgctgctgcaacatactgccaacctcacacagctgaccctggag
aagtaccctgcacctgatgaagtctatgatgacagtctttgtgttattccagacagattt
gtacaactttgttctgagcttatgaacacactcaagggtgtaaggcagccaaagcaggtc
tattttgagagtacaatatattcacctaattttgaatacctcgtgtataatttggagggc
atggtatcttctgagcctttaagaaggagaggtcgtgggatggtgatatatatcagtggg
tag

DBGET integrated database retrieval system