KEGG   Mus musculus (mouse): 353025
Entry
353025            CDS       T01002                                 

Gene name
Caps2, D630005B03Rik
Definition
(RefSeq) calcyphosphine 2
  KO
K23909  calcyphosin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    353025 (Caps2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   353025 (Caps2)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7
Other DBs
NCBI-GeneID: 353025
NCBI-ProteinID: NP_001297604
MGI: 2441980
Ensembl: ENSMUSG00000035694
Vega: OTTMUSG00000023544
UniProt: Q8BUG5
Position
10; 10 D2
AA seq 550 aa
MVPPLDLGSLVDSDEEDNFSQTARGTVHVHLNPPRSEPALGWVLPCQRPNSQHRLQEVEQ
DVIPEDLPAPTGKYRLKYQQYASEMKDGYKQYIQRSTEKPKAASRPEATEKVEGASLDDL
MTLDRKALLQQGYADSPYGRQSITRKSDVETVAIEKKKQTVAEQMMMDHLSRAVISDPEQ
DLNTKNQESSRVPPDSERAPLRVRRRTLHETKIRTNSALTENDLSQKVEFDGRVLSRNGR
DACRELIGFFFAHDQSLTVYEYRMFGKNRTSVLPFIKKDIYHHQCGRRKGKQYELGDVYT
GATLTFLSCDQPSLPKTIKENALLRLRITNIDQVALNSLKAASAEHGEEEAVSPEAHDQL
VLQAIQDKLKEQLHKKGARILTGLGRYFQGLDKEGNGLLEKADFQQALKTFHLEVSEQDF
ESFWLILQGYGHSKNKVDYGEFKRAIFGEMNEYRKSFVRKAFMQLDFNKTGIVSVIDIRK
CYCAKKHPRVISGHSTEEEIKSSFLETLKGTCSKCDEVSYGEFEDYYEGLSIGVAGDEDF
VNILRIPWRI
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggtcccaccacttgatctgggaagccttgttgactctgatgaggaggataatttttca
caaacagcacgtggtacagtccatgttcatcttaacccaccgcggtcagagcctgctctg
ggctgggttctgccatgtcaaagacctaacagtcagcatcgactacaggaagtggaacag
gacgtaatacctgaggatttgccagcgccaacaggcaaatacaggctaaagtaccagcag
tacgcaagtgaaatgaaagacggctacaagcagtatattcagaggagtacagagaagcca
aaggcagccagcaggccagaggcaaccgagaaggtggaaggagccagtctggatgacctc
atgactttggataggaaggccctcttacagcaaggttacgcagatagcccttacggtaga
cagagcatcacgaggaaatcagatgtggagactgtggctatagagaagaagaaacagacc
gttgcagagcagatgatgatggaccacttatccagggctgtcatcagcgacccagaacaa
gatttaaacaccaagaaccaagagagttctcgtgtccctccagactcagagagggcgcca
cttcgcgtcaggagacgaactctgcatgaaacgaagataagaaccaactctgcattaaca
gagaatgacctttctcagaaagtagaatttgacgggagggtcttatcaagaaatggacgc
gatgcctgccgggaactaattgggtttttctttgcccacgaccagtccctaactgtgtat
gaatatcggatgttcgggaaaaacagaacaagtgtgcttccttttattaaaaaagacatt
tatcatcatcagtgtggacgaagaaaaggaaagcaatatgagcttggtgacgtctatact
ggtgcaactttgacatttttgagctgtgatcaacctagccttccaaagaccataaaagaa
aatgcattgcttagacttcgaattacaaatattgatcaagtagctttgaattctctgaaa
gctgcctctgcggaacatggggaagaagaggcagtcagtccggaggctcatgatcagttg
gtgctacaggccattcaggataaattgaaagaacaactgcacaagaagggtgctcgtatt
ttgactggattgggaagatacttccaaggtttggacaaggaagggaatgggcttttagaa
aaggcagattttcagcaagctctgaaaacctttcacttggaagtgtctgaacaggacttt
gagtctttctggctaattctgcaaggatatggccatagcaagaacaaggttgactatgga
gaattcaaacgtgccatttttggtgaaatgaatgaatataggaagtcatttgttcgcaag
gccttcatgcaactggattttaacaaaaccggcattgtgtctgtaatagacataagaaag
tgttactgcgccaagaagcatccacgtgtgatctcagggcattcaacagaggaggaaatc
aaatcatctttcctagagacgttaaaaggcacctgcagcaagtgcgatgaagtttcatac
ggagaattcgaagattactatgaaggcctaagtataggggtagcaggcgatgaagacttt
gtcaacatcttacgtattccgtggagaatttag

DBGET integrated database retrieval system