KEGG   Mus musculus (house mouse): 353167
Entry
353167            CDS       T01002                                 
Symbol
Tas2r123, T2R23, Tas2r23, mGR23, mt2r55, t2r55
Name
(RefSeq) taste receptor, type 2, member 123
  KO
K08474  taste receptor type 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    353167 (Tas2r123)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    353167 (Tas2r123)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Taste
    353167 (Tas2r123)
SSDB
Motif
Pfam: TAS2R V1R
Other DBs
NCBI-GeneID: 353167
NCBI-ProteinID: NP_996908
MGI: 2681264
Ensembl: ENSMUSG00000057381
UniProt: P59528
Position
6:132824105..132825106
AA seq 333 aa
MFSQKINYSHLFTFSITLYVEIVTGILGHGFIALVNIMDWVKRRRISSVDQILTALALTR
FIYVLSMLICILLFMLCPHLPRRSEMLSAMGIFWVVNSHFSIWLTTCLGVFYFLKIANFS
NSFFLYLKWRVKKVILIIILASLIFLTLHILSLGIYDQFSIAAYVGNMSYSLTDLTQFSS
TFLFSNSSNVFLITNSSHVFLPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKQP
RDVSTMAHIKALQTVFSFLLLYAIYLLFLIIGILNLGLMEKIVILIFDHISGAVFPISHS
FVLILGNSKLRQASLSVLPCLRCQSKDMDTMGL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgttttcacagaaaataaactacagccatttgtttactttttcaatcaccttgtatgtg
gaaatagtaacgggaatcttaggacatggattcatagcattagtgaacatcatggactgg
gtcaaaagaagaaggatctcttcagtggatcagattctcactgctttggcccttaccaga
ttcatttatgtcttgtctatgctgatttgcatattgttattcatgctgtgcccacatttg
cctaggagatcagaaatgctttcagcaatgggtattttctgggtagtcaacagccatttt
agcatctggcttactacatgcctcggtgtcttttattttctcaagatagccaatttttct
aactctttttttctttatctaaagtggagagttaaaaaagtgattttaataataatcctg
gcatcactgattttcttgactttacacattttatctttagggatatatgatcagttctca
attgctgcttatgtaggaaatatgtcttatagtttgacagatttaacacaattttccagt
actttcttattctccaactcatccaatgttttcttaatcaccaactcatcccatgttttc
ttacccatcaactccctgttcatgctcatacccttcacagtgtccctggtagcctttctc
atgctcatcttctcactgtggaagcatcacaaaaagatgcaggtcaatgccaaacaacct
agagatgtcagtactatggcccacattaaagccttgcaaactgtgttctccttcctgctg
ctgtatgccatatacttacttttccttatcataggaattttgaaccttggattgatggag
aaaatagtgatactgatatttgaccacatttctggagcagtttttcctataagccactca
tttgtactgattctgggaaacagtaagctgagacaagccagtctttctgtgttgccttgt
ctaaggtgccagtccaaagatatggacaccatgggtctctag

DBGET integrated database retrieval system