KEGG   Mus musculus (mouse): 353172
Entry
353172            CDS       T01002                                 

Symbol
Gars, GENA202, Gars1, Gena201, Nmf249, Sgrp23
Name
(RefSeq) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    353172 (Gars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    353172 (Gars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    353172 (Gars)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    353172 (Gars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     353172 (Gars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   353172 (Gars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    353172 (Gars)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    353172 (Gars)
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b WHEP-TRS DUF5915
Other DBs
NCBI-GeneID: 353172
NCBI-ProteinID: NP_851009
MGI: 2449057
Ensembl: ENSMUSG00000029777
Vega: OTTMUSG00000057767
UniProt: Q9CZD3
Position
6:55014986..55056489
AA seq 729 aa
MPCLLPSLLRATRAALPLLSPPRVVAASASQRLLSAPAQPAASRSSMDSAEELLAPLRLA
VRQQGDFVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKR
RFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDCTMLTPEPVLK
TSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYG
QQELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKR
LLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFQSVAD
LCLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFR
QHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPK
TVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEMELLLSEKGEFTIETEGKTFQ
LTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAV
VAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGI
TIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRDLANGNITWADVEARYPLFEGQE
TGKKETVEE
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgccctgtctgctcccctcgctgctcagagccacccgcgccgcgctgccgctcctgtcg
ccgccccgagtggtcgcagcgtccgcgtctcagcggctcctcagcgctcccgcgcagccc
gccgcctcccggagcagcatggacagcgcggaggagctgctggccccactgcggctagcc
gtgcgccagcagggagactttgtacggaagttaaaagaagataaagccccacaagtggat
gtggacagagcagtagctgagctcaaggcccggaagagggttctggaagcaaaggagctg
gcattgcagcccaaagatgacatcgtagatagagcaaaaatggaagatacgttgaagagg
aggtttttctacgatcaggcttttgctatttatggaggtgtcagtggattgtatgacttc
gggccggtaggatgtgctttgaagaacaatatcatccaggcctggaggcagcactttatc
caagaggagcagatcctggagattgactgcaccatgctcacccctgagccagttttaaag
acctctggccacgtagacaaatttgctgacttcatggtgaaggacgtgaagaacggagag
tgcttccgagcagaccacctgttgaaagctcatttacagaaactgatgtcagataagaag
tgctctgctgagaagaagtcagagatggaaagtgtcttggcccagcttgataactatgga
caacaagaacttgcggatctttttgtgaactataatgtaaaatctcccaccactggcaat
gacctgtcccctccggtaccttttaacttaatgttccagaccttcattgggcctggagga
aatatgcctggatatctgagaccagaaactgcacagggaattttcctgaatttcaaacga
cttttggaattcaaccaagggaaattgccttttgctgctgcccagattggaaactccttc
agaaatgagatctcacctcggtctggactgatccgagtcagggagtttacaatggcagag
attgagcactttgtagatcccactgagaaagaccatcccaagttccaaagtgtggccgac
ctctgcctttatttgtactcagcaaaagcccaggtcactggacagtctgctcggaagatg
cgtctgggagatgctgttgaacagggtgtgattaacaactcagtattaggctattttatt
ggccgcatctacctctacctcacgaaggttggaatatctcctgataaactccgcttccgg
cagcatatggagaatgagatggcccattatgcctgcgactgctgggatgccgagtccaaa
acgtcctatggctggattgagattgttggatgtgctgaccgttcctgctacgacctctcc
tgtcatgctcgagccaccaaagttccactagtagctgagaaacctctgaaagaacccaaa
acagttaacgttgtacagtttgagcccaacaagggcgccgtgggcaaggcgtacaagaag
gatgcaaagctagtgctggagtatctcagcgcctgtgatgagtgctacatttcagagatg
gagctgctgctgagtgagaaaggggaattcactattgaaactgaaggaaaaacatttcag
ttaacgaaagacatggtcagtgtgaagagattccagaaaacactgcatgtggaagaagtt
gttccgagtgtaattgagccctcctttggcttgggcaggatcatgtataccatattggaa
catacattccatgtccgagagggagatgaacagagaacgttcttcagtttccctgctgtg
gttgctccattcaaatgttctgtccttccactgagccagaaccaagagtttatgccattt
gtcaaggaattatccgaagctctgaccaggaacggcgtgtctcataaagtcgatgactcc
tctgggtctattggaaggcgctatgcaagaactgatgagattggcgtggctttcggcatc
actattgactttgatacagtgaacaagacgccccacactgcaactctgagggaccgagac
tccatgagacagataagggcagaggtctctgagctgcccaatgtggtccgcgatctggcc
aacggcaacattacctgggctgatgtggaggccaggtacccactctttgaagggcaagag
actggcaagaaggagacagtagaggaatga

DBGET integrated database retrieval system