KEGG   Mus musculus (mouse): 353187
Entry
353187            CDS       T01002                                 

Gene name
Nr1d2, RVR, Rev-erb
Definition
(RefSeq) nuclear receptor subfamily 1, group D, member 2
  KO
K08531  nuclear receptor subfamily 1 group D member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    353187 (Nr1d2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    353187 (Nr1d2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    353187 (Nr1d2)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   353187 (Nr1d2)
SSDB
Motif
Pfam: zf-C4 Hormone_recep LpxD
Other DBs
NCBI-GeneID: 353187
NCBI-ProteinID: NP_035714
MGI: 2449205
Ensembl: ENSMUSG00000021775
Vega: OTTMUSG00000033210
UniProt: Q60674 Q4VAB7 Q8C6J1 Q8C598
Position
14; 14 A2
AA seq 576 aa
MELNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNCDANGNPKNADI
SSIDGVLKSDRTDCPVKTGKTSAPGMTKSHSGMTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNTQFSGHLQNDTLAEQHDQSALPAQEQLRPKSQLEQENIKN
TPSDFAKEEVIGMVTRAHKDTFLYNQEHRENSSESMPPQRGERIPRNMEQYNLNQDHRGS
GIHNHFPCSERQQHLSGQYKGRNIMHYPNGHAVCIANGHCMNFSSAYTQRVCDRIPVGGC
SQTENRNSYLCNTGGRMHLVCPMSKSPYVDPQKSGHEIWEEFSMSFTPAVKEVVEFAKRI
PGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLL
SSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKN
HPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggagctgaacgcaggaggtgtgattgcctacatcagttcctctagctctgcctccagc
cctgcctcttgtcacagtgagggttctgagaatagcttccagtcctcgtcctcgtctgtt
ccatcttctccaaatagctctaactgtgatgccaacggcaatcccaagaacgctgatatc
tctagcatcgatggtgttctgaagagtgaccgcacagattgtcctgtgaaaacaggcaaa
accagtgctcctggcatgactaagagtcacagtggaatgacaaaatttagtggcatggtt
ctactgtgtaaagtctgtggggatgtggcatcaggattccactatggagttcatgcttgt
gaaggctgtaagggtttctttcggaggagcattcagcaaaacatccagtataagaagtgc
ctgaagaatgagaactgttccatcatgaggatgaacaggaaccggtgccagcagtgccgc
tttaagaagtgtctgtctgtggggatgtcacgagatgctgttcgatttggccgaattcct
aagcgtgaaaaacagagaatgctaattgaaatgcaaagtgcaatgaagaccatgatgaac
acccagttcagtggccacctgcagaatgacaccttagcagaacagcatgatcagtcagca
ctaccagctcaggaacagctgcggcccaagtcccagctggagcaagaaaacatcaaaaac
actccttctgattttgcaaaggaggaagtgattggtatggtgaccagagcccacaaggat
acctttctgtataatcaggaacatcgagaaaactcatctgagagcatgccacctcagaga
ggagaacggattcccaggaacatggagcaatataatttaaatcaagaccatcgtggcagt
gggattcacaaccacttcccctgtagtgagaggcagcaacatctcagtggacagtacaaa
gggaggaacataatgcattacccaaacggccatgccgtttgtattgcaaatggacactgt
atgaacttctccagtgcttatactcaaagagtctgtgatagaattccagtaggtggatgt
tctcagactgagaacagaaatagttacctgtgcaacactggagggaggatgcatctggtg
tgtcctatgagcaagtctccatatgtggaccctcagaagtctggacatgaaatctgggaa
gaattttcaatgagttttaccccagcagtaaaagaggtggtggaatttgcaaagaggatt
cctggcttccgagatctgtctcagcatgatcaggtcaatctgttaaaagctgggactttt
gaggttttaatggtacgatttgcttcattatttgatgcaaaggaacggactgtcaccttt
ctaagtggtaagaagtacagtgtggatgacctgcactcaatgggagcaggggatctgctc
agctctatgtttgagttcagtgagaagctgaatgccctccagctcagtgatgaggaaatg
agcttgttcacagcagttgttctggtatctgcagatcgatctggaattgaaaatgtcaac
tcagtggaggctttgcaggaaacactcatccgtgcactaaggaccttaataatgaaaaac
catccaaatgaggcctccatttttacaaaattacttctaaagttgccagatcttcgatct
ttaaacaacatgcactctgaggaactcttggcctttaaagttcatccttaa

DBGET integrated database retrieval system