KEGG   Mus musculus (mouse): 353190
Entry
353190            CDS       T01002                                 

Symbol
Edc3, AA517853, Lsm16, Yjdc
Name
(RefSeq) enhancer of mRNA decapping 3
  KO
K12615  enhancer of mRNA-decapping protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    353190 (Edc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    353190 (Edc3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     353190 (Edc3)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     353190 (Edc3)
SSDB
Motif
Pfam: Edc3_linker YjeF_N FDF LSM14 DUF5096
Other DBs
NCBI-GeneID: 353190
NCBI-ProteinID: NP_722494
MGI: 2142951
Ensembl: ENSMUSG00000038957
Vega: OTTMUSG00000033365
UniProt: Q8K2D3 A0ELI5
Position
9; 9 B
AA seq 508 aa
MAMDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDIT
ELKILEIPGPGDNQQVGDLHQTELGPSGVGYQMSISQNGTGKVVKKPASSSSAPQSIPKR
TDVKSQDVAISPQQQQCSKSYVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLK
NGQMKNKDDECFGDDIEELPDTDFDFEGNLALFDKAAVFEEIDTYERRSGSRSRGVPNER
PARYRHDENILESEPIVYRRITVPHSVSKEFCTDSGLVVPSVSYELHKKLLSVAEKHGLT
LERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANH
DVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLRDLPASPVDLVINCLDCPENAFLR
DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRVYLCDIG
IPQQVFQEVGINYHSPFGCKFVIPLHSA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggctatggattggctaggcagtattgtgtccatcaactgtggagatagcctgggcgtc
taccagggaagagtatcagcagtggatcaggtcagccagaccatttctcttactcggccc
ttccacaatggggtgaagtgtcttgtaccagaagtcacctttcgggcaggtgatattaca
gaattaaaaattttggagataccaggtcctggagacaaccagcaggttggagaccttcat
cagacagaattaggcccttctggtgttgggtaccaaatgagtatcagtcagaatggaaca
ggcaaggtggtcaagaagccagcctcttccagtagtgcccctcagagcatccctaagagg
acagatgtgaagagccaggatgttgccatttctcctcagcagcagcagtgctcaaagagt
tatgtggacaggcacatggaatctttgagtcagtccaaaagcttccgtcgtcggcacaac
tcctggtcatctagtagcaggcacccaaaccaggcaactccaaagaaaagtggtttaaaa
aatggccagatgaagaataaagatgacgagtgctttggagacgatatcgaggagctccca
gacacggactttgactttgaggggaacctggccctgtttgacaaggcggctgtgtttgag
gagatcgacacttacgagaggagaagtggctcccgttctcggggtgtcccaaatgaacgt
cctgctaggtaccgccatgatgaaaacatcctggaatcggagccgattgtgtaccgtagg
atcacagtaccacacagcgtgagcaaggagttctgcacggactctggcctggtagtccca
agtgtttcctatgagctacataaaaagctgttgtctgtggctgagaagcatgggctgacc
ttagagcggagacttgagatgactggtgtgtgtgccagtcagatggcgctgactctcctt
ggaggacccaacaggttgaatcctaagaatgtccaccagaggcccacagtagctctcttg
tgcggcccccatgtgaagggggctcagggcatcagttgtgggaggcacctcgccaaccat
gatgtgcaagtcatcctcttcctgcccaactttgtcaagatgctggagtctattaccaac
gagctgtctctcttcagcaagacccaagggcagcaagtgtctagcctaagagatctccct
gctagccctgtggacctggttatcaactgcctggattgtcctgagaatgccttcctgcgg
gatcagccctggtacaaggcagctgtggcctgggccaaccagaaccgggcaccagtgctc
agcatagaccctcctgtgcatgaagttgaacagggcattgatgccaaatggtccctggca
ctgggcctgcctctgccactcggggagcacgcaggccgagtctatttgtgtgacattggc
attccccagcaagtcttccaggaggttggcatcaactaccattcaccttttggctgcaaa
tttgtcattcccctacactctgcctag

DBGET integrated database retrieval system