KEGG   Mus musculus (house mouse): 353236
Entry
353236            CDS       T01002                                 
Symbol
Pcdhac1, CNRc1
Name
(RefSeq) protocadherin alpha subfamily C, 1
  KO
K16493  protocadherin alpha
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    353236 (Pcdhac1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    353236 (Pcdhac1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    353236 (Pcdhac1)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   353236 (Pcdhac1)
SSDB
Motif
Pfam: Cadherin Cadherin_tail Cadherin_2 Cadherin_C_2 DUF3504 Cadherin_4 DUF5527
Other DBs
NCBI-GeneID: 353236
NCBI-ProteinID: NP_001003671
MGI: 1891442
Ensembl: ENSMUSG00000103255
UniProt: Q91Y10
Position
18:37223189..37320710
AA seq 964 aa
MVGWGMAVLCWWVSCGAAAGQLEYSVLEETEPGVTVGNIASDLKLSAAVLSLRNFRFLSN
YRESYFGVDLGSGSLVVQELADREQLCPAKASCILTYELMFEDPLELHKIRVHLLDTNDN
SPLFPAGDVHLHIPEFLPPGARFILPNAQDADEGSNGALSYSLSISQHFRLDMGSRVDGS
KYPELVLEKALDREQRDTHLLVLTAQDGGLPARSGAAQVTITVVDTNDNAPVFEHSVYST
KVPETAPNGTVLFHVQALDPDEGSNGEVWYSLSNSTPAELRHLFHVHPKSGEVQVAASLG
PPETLLEAFVEARDEGAFSLASTTKLLVEVTDVNDHAPQMDFMTFSSSILEDAAPGTVIA
LLSVKDEDLGSNGKVTCSMSSKGPFQLKASFDSYYRLLTDGPLDREQASEYQILISASDG
GSPPLSTRRTLTVSVADVNDNTPNFPQPQQELFVAENNSPGVSLGGVFAQDPDLGENGFV
FYELLDVISERMPVSSSLVAVEPTTGVITAKTSFDFEQLRGFNFQVEGRDGGIPPRSATV
TVNLFVVDRNDNAPDILFPLPRNGSIPVERVPRFARAGHLVTKVVAEDADSGSNAWLSYH
ISQASDSSLFRISVNTGELRTARLVFPTDAVKQSVVVVVQDHGEPPLSSSVILGVLLSNA
APQVIPDFEDIWEPRAQLSARNLYLIIALVCISFLFLGCLFFFVCIKLNQSPDCCSQNFC
HSPENERHKRTMASSPWVTSATIDVTTVERLSQTYLYQASLGPGYGNNSFFLHGKYKAAD
LRNLAPGVGMNLPVSCVQIRNRKGDHSNVEAVPRQPNPDWRYSASLRAGMHSSVHLEEAG
ILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPD
KFIIPGSPAIISIRQEPANNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTD
NSDQ
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggtgggctggggaatggcggttctgtgttggtgggtctcttgtggtgctgcagcggga
cagctggagtattcggtgttggaggagacggaaccgggagttactgtaggcaatatcgcc
tcggacttgaagctgtcagcagctgttctgtccttgcggaactttcgcttcctttccaac
tacagagagtcctacttcggggtcgacctgggcagcggtagcttggtggttcaagagcta
gcggaccgcgagcagttgtgcccggccaaagcttcttgcatcctgacatatgagctaatg
tttgaggaccctctagagctgcacaaaatacgtgttcaccttctagacaccaacgacaat
tcacctctcttccctgctggagatgtgcacttgcacatcccggagttcctgccaccggga
gcccggttcattcttccgaatgcccaagatgccgatgagggaagcaacggcgcgctaagt
tacagcctaagcattagccagcactttcgcctggacatgggatcgcgggtcgatggtagc
aaatacccagagctggtgctagagaaagcgctggatcgagagcagcgggacacccacctg
ctggtgctcactgctcaggatggtggcctgcctgcacgctctggggccgctcaagtcact
atcactgtggtggacaccaacgacaatgcacctgtatttgagcactccgtatacagtact
aaggttccagagactgcacccaatggaactgtgctattccacgttcaagccttggatccg
gatgaaggatccaatggagaagtctggtactccttaagcaatagcacaccagcagagctg
aggcacctctttcacgtacatcctaaaagtggggaggttcaagtagctgcttcactaggt
ccaccagaaacgttattggaagcatttgttgaagcaagagatgaaggtgcttttagtcta
gctagcactactaaactgcttgtggaggtgactgatgtgaacgatcatgccccccagatg
gacttcatgaccttctccagctcaatactcgaggatgcagctcctggcacagtgattgct
ctccttagtgtaaaggatgaggacctaggttccaatggtaaggtcacttgtagcatgtcc
agcaaaggcccctttcagttgaaggcttcctttgatagctactacagactgctgaccgat
gggcccctggatcgggagcaagcaagtgaataccagatcctgatctctgcttcagacggt
ggctcacccccattaagtacccgaaggacactcactgtgtcagttgctgatgtgaatgac
aacacaccaaactttcctcaaccacaacaggaactttttgtggctgaaaacaatagccct
ggagtttccttaggcggtgtgtttgctcaggacccagatctgggggagaatggctttgtc
ttttatgagctgttggatgtcatttctgaacggatgccagtttcctccagcttggtggca
gtggaaccaaccactggtgttatcactgccaaaacttcctttgactttgagcagctcagg
gggtttaacttccaagtggaaggccgagatggtggcattcctcccagaagtgcaacagtg
actgtgaacttgtttgtggtagacaggaatgacaatgcaccagacatcttgtttcccttg
cctagaaatggctctatcccagtggaaagagtgccccgctttgcccgagctggacaccta
gtcacaaaagtggtagcagaggatgcagacagtggttccaatgcctggctctcctaccac
atttctcaggcttctgactctagtcttttcagaatttcagtcaacaccggagagctgcga
actgcacgtttagtgtttcccactgatgcggtcaagcagagcgtggtggtagtggttcag
gaccacggagagccaccgctttcctcctctgttattctgggtgtgctgttgagcaacgca
gctcctcaggtcattccagactttgaagatatctgggaaccaagagcacagctttctgcc
cggaacttgtacttgataatagccctggtctgcatttcctttttatttctggggtgcttg
tttttctttgtgtgcatcaagttgaaccagagcccagattgttgctctcagaacttctgt
cattctccagaaaatgagagacacaagaggacgatggcttctagtccttgggtgacatca
gccacaatagatgtcaccacagtcgagagactttctcagacatatctctatcaagcttct
ctgggacctggttatggtaataacagctttttcttgcatgggaaatacaaggctgctgat
ctgagaaatctggcccctggtgtaggaatgaatttgccagtatcctgtgttcagattcgg
aataggaaaggggatcattcaaatgtggaagccgtgccccggcagcccaaccctgactgg
cgctactctgcctcgctaagagcaggcatgcacagctctgtgcacctggaggaggctggc
attctacgggctggtccaggagggcctgatcagcagtggccaacagtatccagtgcaaca
ccagaacctgaggcaggagaggtgtcccctccggtgggcgccggtgtcaacagcaacagc
tggacctttaaatacggaccaggcaaccccaaacagtccggtcccggtgagttgccagac
aaattcattatcccaggatctcctgcaatcatctccatccggcaggagcctgctaacaac
caaattgacaaaagcgattttataaccttcggcaaaaaggaggagaccaagaaaaagaag
aaaaagaagaagggtaacaagacccaggagaaaaaagagaaagggaacagcacgacggac
aacagtgaccagtga

DBGET integrated database retrieval system