KEGG   Mus musculus (mouse): 353326Help
Entry
353326            CDS       T01002                                 

Gene name
Rtl1, 6430411K18Rik, Mar, Mart1, Mor1, Peg11
Definition
(RefSeq) retrotransposon Gaglike 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RT_RNaseH_2 DUF4939 Retrotrans_gag RT_RNaseH gag-asp_proteas Asp_protease_2 RVP_2 RVT_1 Asp_protease
Motif
Other DBs
NCBI-GeneID: 353326
NCBI-ProteinID: NP_908998
MGI: 2656842
Ensembl: ENSMUSG00000085925
UniProt: Q7M732 B4YB44
Position
12; 12 F1
AA seq 1744 aa AA seqDB search
MIEPSEDSFETMMELKNPSSKQMESSEGSSNTVEETPGSSGAQAGAQAGAQAEAQAETQV
EAQAEAQAEAQVEAQVEAQAGSDSGPAQEEKEPPSGPLKEMQELPTNLLQEVEEPSSGPH
QEMQELPTDLLQEVEEPSSGPHQEMQELPTDLLREVEEPSSGPYQEMQELPTDLLREVEE
PSSGPYQEMQELPTDLLREVEEPSSGPYQEMQELPTDLLREVEEPSSGPYQEMQELPTDL
LREVEEPSSDPCEASSNDLPQDMEESSDDGSNQESSDGSNHELSNGSNHESSFGSNPESS
DVSNLESSGGSNQESSDGSQKESSYDSNPELSDNSNQELSDNSNQESSDSSNQSSDISNQ
EGSEPLSEASDYSMDETINSSETQSDQDDTDLGDDEEEEEEEGGEEEGQPKNSPEEVVAT
MGNVISLFLRMQDLKEQQRVAERLMMQAINEGRLPSLRPFSGDRRDYHEFVVLCQMTMQN
YPSMLYNDELRVKFVIRHLTDLALEWANDLVEQNSPVINNFSAFLEAMSEKFEYRQTLRV
AEDAMFNIRQGNRCAADYINEFRGLIPTLGWPDEVLQAHLCQGLNEEIRHYLFRIPQPNS
LDNLIVLVLQLEEKLAERRALLRLPPESRPRSVAWMDAPAPEKWRVSSWLPNEFHPDIDR
DHLFLLLLVRVDPYHSVAVRALVDSGAEGNYMDERFAQEHYVELYEKPYPQIIQGVDGIP
IGNEPVWLCTEPLVCVHQKHYEYIEFDILPSPNFSIVLGMKWLRTHAPEVDWMRGRCTFH
SPYCLRNCFTPPPPCIALETYSISLLPGLPHTYSDLADVFNPREADDETSDQPSSDGSDD
LSESEPSELQQAGDSDQSGVFYESGARETLEPVSARMQEKARQQEKAREQEEYWILYDML
TDRQDYTQMVPELFDQLHGAAWFTKLELLGIKESEMRHTVTHTEDTWRASFGFGLHQMRC
YRPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYH
NIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPY
RHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLET
DITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIRAAFMVWCRYLE
NTEEPIMILLNTEDLASLNNDRLTVLLPGHWVFFFSHFNFGVMEMPAEGDTQALFRRCWN
QRGFRARFLRPLLLMSIRANLRYFDRSSETEDKEDDEEEEEEDGEEEEGEEEEDGEEEEG
EEEEDGEEEEEEEEDDEEEEGEEEEDGEEEEGEEEEDGEEEEGEEEEDGEEEEGEEEGEE
EEEGEEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDEEEEDEEEEDEEVPSM
VRELLAAIPMDHILNGLLAHFSVAQIRAVVLNFFRGLLYWKSLLGVAAVLVMLRARQPLS
PVPAPNLEVARPQHRHTLRLILDSTLIASSGMATAIAQLLSQMPPLVGANTLPARELAEL
FLGPRCWHRNALHSQPPRGMRFTPGFWLTLCEFFGVRVNPEDDVFPDPYQHRYLELHVVG
DEDVVLREALQDDLQRYRQCGLHDGLQDTSQDAQDNDVQEDLFGDQEAVTFRPRNLLDPE
VLDFLNNRLLYTLGTDGRLTLLSRDQVAQALTRFLAMASRMALPSPAREQARLEELSDSD
DELD
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaccctctgaagactcatttgagacgatgatggagcttaagaatccatcatca
aaacaaatggagtcctccgagggctcatccaacaccgttgaagagacaccaggcagcagt
ggagcccaggcgggggcccaggcaggggcccaggcggaggcccaggcggagacccaggtg
gaggcccaggcggaggctcaggctgaagcccaggttgaggcccaggttgaggcccaggcg
ggctcagatagtggcccagcccaggaagaaaaggagccacccagtggccccctcaaggaa
atgcaagagctgcccactaatctactccaagaagtggaggagccatccagtggcccccac
caggaaatgcaagagctgcccactgatctactccaagaagtggaggagccatccagtggc
ccccaccaggaaatgcaagagctacccactgatctactccgggaagtggaggagccatcc
agtggcccctaccaggaaatgcaagagctacccactgatctactccgggaagtggaggag
ccatccagtggcccctaccaggaaatgcaagagctacccactgatctactccgggaagtg
gaggagccatccagtggcccctaccaggaaatgcaagagctacccactgatctactccgg
gaagtggaggagccatccagtggcccctaccaggaaatgcaagagctacccactgatcta
ctccgggaagtggaggagccatccagcgacccctgtgaggcatcatctaacgatctaccc
caagacatggaggaatcaagtgatgatggttcgaaccaggagtcgagtgatggttcaaac
cacgaattaagtaatggttcaaaccatgagtcgagctttggttcaaacccagagtcgagc
gatgtttccaacctggagtcaagcggtggttcaaaccaggagtccagcgatggttcacaa
aaggagtcaagctatgattcaaacccggagttaagtgataattcaaaccaggagttaagc
gataattcgaaccaggagtcaagcgacagttcaaaccagtcaagtgatatttcaaaccag
gaagggtcggaaccactcagtgaggcatccgattatagcatggatgaaacaatcaactca
tccgagacccagtcagaccaagatgatactgacctgggagatgacgaggaagaggaggaa
gaggaaggtggtgaagaggaaggtcagcccaagaactctccagaagaagtcgtggccacc
atggggaacgtcatctcgctgttcctccggatgcaagacctaaaagaacaacagagagtg
gcagaaaggctcatgatgcaggctatcaacgaaggtcgcctgccctccctcaggcccttc
tctggagatcgcagagactaccatgagtttgtcgtgctctgccagatgacaatgcagaac
tacccaagtatgctatacaatgatgagctgcgggtgaaattcgtcatccgccacctgact
gacctagccttggaatgggccaacgacctcgtagagcagaacagcccagtgataaacaac
ttctcagccttcctggaggccatgtcagaaaagtttgagtatcggcagaccctgcgtgtg
gcggaagacgccatgttcaacatcaggcaggggaaccgctgtgcggccgattacatcaat
gagttccggggtctgatacccaccttaggctggccagatgaagtcctgcaggcccacctg
tgccaggggctcaacgaagagatcaggcactatctgttccggatccctcagccgaattcc
ctagacaacctgattgtacttgtcctgcaacttgaagaaaagctggcagagagaagagca
ttactcaggctgccacctgagtcgcgcccaagaagcgtagcctggatggatgctcccgcc
ccagagaagtggagggtaagcagctggctgcccaatgagttccacccagacattgatcgc
gatcacctcttcttactgctcttggtgagagtggacccctaccacagtgtcgcagtgcgg
gccctggtggactcaggagcagaagggaactacatggatgagaggtttgcccaggaacac
tatgtggaactctatgagaagccttatccacagataatccaaggtgtggatggcatccca
attggcaatgaacccgtctggctgtgcaccgagcccctggtatgtgtccaccagaagcat
tatgagtacatcgaatttgacatcttaccttcgcccaacttctccatcgtcttaggcatg
aagtggctccgaacccatgcccctgaagtcgactggatgagaggccggtgtaccttccac
tctccctactgtctgcggaattgcttcaccccacctccaccatgcatcgcactagagaca
tacagcataagcctactgcccggattgccacacacatactcagacctggccgacgtgttt
aacccgagggaggcagatgatgagacttccgaccagccaagctcagacggatccgatgat
ctttctgaatcagagccctctgagcttcagcaggctggagacagtgatcaaagcggcgtc
ttttacgagtctggggcccgagagactttggaacctgtgagcgccaggatgcaagagaaa
gccaggcagcaagagaaagccagggagcaagaggaatactggatactgtatgacatgctg
actgacagacaagactacacgcagatggtaccagagctattcgaccagctacatggagcg
gcatggttcacaaaactggagctgcttgggattaaggaaagtgagatgaggcacacggtc
acacacacggaagacacttggagagcatcgttcggtttcggccttcaccagatgagatgc
taccggcccttcacaatgaactcatactctgacgaagggaacaacattgttcacttcatc
ctaaaagacatcctagggttgtttgtgatttgccatggcagagaggtcctggtctactca
atgagccaggaggaacactcccagcatgtccgccaagtcctggtccgctttcggtatcac
aacatctactgttcactggacaaaactcagttccatcgccagaccgctgaaatcttgggc
ttcaacatatcccccaaaggggtgaaactgaacaagaaccttatgaacctcatcgtgggg
tgccctgtccctggcagcaggaggtgtcttcaaagtgtgattgaccttgtctatccctat
cgccacttcgtggagaacttcgctgtcatcgcagcacccctagtgagacaactgctgagt
tcagagccctactactggggagaagaggagcaggaggccttggaatccctgaagagggct
ttccgcaagtcgcccgttctctatcaccctaagcctcagaacccattctacttggaaaca
gacatcactgggtcattcctgtctgcctccctggtccaaaccgacgacgaaactggcaag
aaatctacctgtgctttctattcaagacccctctctacaatggaggtggagtaccctcga
gtggagatgaggatccttccaatccgggctgccttcatggtgtggtgccgctacctggag
aacaccgaggagcccatcatgatccttctcaacacagaggatctagcctctctgaataat
gacaggctcaccgtacttctccccgggcattgggtcttcttcttctcacacttcaatttt
ggtgttatggagatgccagctgaaggtgacacacaagcactcttccgcagatgttggaac
cagagaggcttcagagcaaggtttctgcgcccactgctgcttatgtccattagggcaaat
ctaaggtactttgacagatcctctgagactgaggataaagaggatgatgaagaagaggag
gaggaagatggtgaagaagaagaaggggaggaggaggaagatggtgaagaagaagaaggg
gaggaggaggaagatggtgaagaagaagaggaggaggaggaagatgatgaagaagaagaa
ggggaggaggaggaagatggtgaagaagaagaaggggaggaggaggaagatggtgaagaa
gaagaaggggaggaggaggaagatggtgaagaagaagaaggggaggaggagggagaggag
gaggaagaaggagaggaggaagaggaggaagaagaggatgaggaggaagaggaggaggaa
gaggaagaggaggaagaagaggaggaagaagaggaggaggaggaagaggaggaagaagag
gaggaggaagatgaggaagaagaggatgaggaggaagaagatgaggaggtgcccagcatg
gtgcgggagctactggctgccatcccgatggaccatatcctcaatggcttactggctcac
ttcagtgtggcccagatccgggccgttgtcctaaacttcttccgtggcctgctctactgg
aagagtctcctgggtgtggcagctgtcctggtgatgttgagagcaaggcagcccctctcc
ccagtgcctgcccctaatttggaagtggccaggcctcagcaccggcacacactccgactc
atcctggactcgaccctcattgcgagtagtggcatggccacagccatcgctcagttgctc
agccagatgccccctctagtgggtgccaacaccctcccagctcgagagctggctgagctt
ttcctgggcccaaggtgctggcatcggaatgctctgcattcccagcctccacgggggatg
cgcttcacccctgggttctggttgaccctgtgtgagttctttggggtcagagtcaaccct
gaggatgacgtctttcctgacccttaccagcaccggtacttggaactgcacgtcgttggg
gatgaagatgtcgtcttgcgagaagccctgcaagacgacctgcaacgttaccgtcagtgt
ggcctgcatgacggcctgcaagacacctcgcaggacgcgcaggacaacgacgtgcaagag
gacctgtttggcgaccaggaagcggtcaccttcagaccacgaaatcttttggacccagag
gtcctagatttcctcaacaaccggctactctacaccctgggcaccgatggccgccttact
ctgcttagcagagatcaggtggcccaggccctcacacgattcctggccatggcctccaga
atggcgctgccttccccagccagggaacaggcaaggctagaagagctatcagactcagat
gatgaacttgactga

DBGET integrated database retrieval system