KEGG   Mus musculus (house mouse): 353371
Entry
353371            CDS       T01002                                 
Symbol
Oxct2b, Scot-t2
Name
(RefSeq) 3-oxoacid CoA transferase 2B
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    353371 (Oxct2b)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    353371 (Oxct2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     353371 (Oxct2b)
SSDB
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Other DBs
NCBI-GeneID: 353371
NCBI-ProteinID: NP_862907
MGI: 2664115
Ensembl: ENSMUSG00000076438
UniProt: Q9ESL0 A0A0R4J198
Position
4:123010041..123011793
AA seq 520 aa
MAALRLLAWALPRGVSALRPRPALPHRLIRRYVSDRSGSVHFYTDPVKAVEGVKDGSTVM
LGGFGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRRVVCSYLGENA
LCEKLYLAGELELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTLVQEGGSPIRYAPDGHL
ITLSEPREVREFQGRFYLLEHAIRADFALIKGWKADRSGNVIFRGSARNFNVPMCKAADI
SVVEVEEIVDVGTFAPEDIHIPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDPSR
TRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKNEVDAD
VINAGKQTVTVVPGGCFFASDDSFAMIRGGHLQLTMLGAMQVSQYGDLANWMVPGKKVKG
MGGAMDLVSSKKTRVVVTMEHCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSK
GLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQQIKLDA
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggcgctgaggcttctggcctgggcgctcccacgtggggtctctgctctccgccca
cgacctgcgctgccccaccgccttatccgccgctatgtttcggaccgcagcgggagtgtc
catttctacacggacccggtgaaggcggtggagggcgtcaaggatgggtcgaccgtcatg
ctcgggggcttcgggctctgcggcatccccgagaacctgatcggtgcgctgaagaccaag
ggcgtgaaggacctgaagatcgtcagcagcaacgtgggcgtggacgacttcggcctgggc
atcttgctggcctccaagcaggtcaggcgcgtggtgtgctcctacctgggggagaacgcg
ctctgcgagaagctctacctggcgggcgagctggaactggagatgacgccgcagggaact
ctggccgagcgcatccgcgcgggtggcactggcgtgcccgccttctacacgcccacaggc
tacggaacgctggtgcaggaagggggctctccaatccggtacgcgcccgatggccacctg
attactctaagtgagccgcgagaagtacgcgagtttcagggccgcttctacctgctagag
cacgctatccgcgctgacttcgcactgatcaagggctggaaagccgaccgctcgggcaac
gtgatcttcagaggcagcgcgcgcaacttcaatgtgcccatgtgcaaggccgcggacatc
tcggtggtagaagtggaggagatcgtggacgttggtactttcgccccggaagacatccac
atccccaacatctatgtggaccgcgtgatcaaggggccgaagttcgagaagcgcatcgag
cgcctaaccacacgtgacagcaagcccgcgcccgggagcaaagacaatgacccttccagg
acgcgcatcatcaagcgcgcggctctggagttccaggacggcatgtatgccaatctgggc
atcgggatccctgtcttggcgagcaactacatcagccccaagatgaccgtctacctgcac
agtgaaaacggaatcctgggcttgggcccgttccctttgaaaaatgaggtagatgccgac
gtcatcaacgcaggcaagcagacagtgacggtggttcccgggggctgtttcttcgccagc
gatgactcttttgccatgattcgtggcggacacctccaactgaccatgcttggggccatg
caagtttctcaatacggcgacctggccaactggatggtgccaggcaagaaggtgaagggc
atgggtggggccatggacttggtgtctagtaaaaagaccagagtggtagtcaccatggaa
cactgtaccaagacaaagcagcccaaaatcttgaagaaatgcaccatgccgttgactggc
aagcgctgcgtggacctcatcatcactgagaaggcggtgtttgaagtgaaccactcaaag
gggctgacgctggtggagctgtgggagggctcgtcggtagatgacatcaaggccaccaca
gcctgttcatttgctgtgtcccccaacctcaagcccatgcagcagattaaacttgatgct
tga

DBGET integrated database retrieval system