KEGG   Mus musculus (house mouse): 360198
Entry
360198            CDS       T01002                                 
Symbol
H3c1, H3c10, H3c11, H3c8, Hist1h3a
Name
(RefSeq) H3 clustered histone 1
  KO
K11253  histone H3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    360198 (H3c1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    360198 (H3c1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    360198 (H3c1)
  09165 Substance dependence
   05034 Alcoholism
    360198 (H3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    360198 (H3c1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    360198 (H3c1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    360198 (H3c1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360198 (H3c1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa
Other DBs
NCBI-GeneID: 360198
NCBI-ProteinID: NP_038578
MGI: 2668828
Ensembl: ENSMUSG00000069265
UniProt: P68433
Structure
Position
13:complement(23945868..23946369)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctagccaccaaagccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcctgtgaggcctac
cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccaactggcccgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system