KEGG   Mus musculus (house mouse): 360216
Entry
360216            CDS       T01002                                 
Symbol
Zranb1, 9330160G10Rik, D7Wsu87e, Gm1956, Trabid
Name
(RefSeq) zinc finger, RAN-binding domain containing 1
  KO
K11862  ubiquitin thioesterase ZRANB1 [EC:3.4.19.12]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    360216 (Zranb1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    360216 (Zranb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     360216 (Zranb1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C64
   360216 (Zranb1)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    360216 (Zranb1)
SSDB
Motif
Pfam: AnkUBD OTU zf-RanBP DZR
Other DBs
NCBI-GeneID: 360216
NCBI-ProteinID: NP_997185
MGI: 106441
Ensembl: ENSMUSG00000030967
UniProt: Q7M760
Position
7:132532905..132588127
AA seq 708 aa
MSEHGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEG
GSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESP
QSSGSGSRPVAFSVDPCEEYNDRNKLNTRTQHWTCSVCTYENWAKAKKCVVCDHPRPNNI
EAIELAETEEASSIINEQDRARWRGGCSSGNSQRRSPPTTKRDSEVKMDFQRIELAGAVG
TKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLTADEV
RLLNRPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIA
ASLHQRKGDFACYFLTDLVTFTLPADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINW
SLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTR
WKDWESWYSQSFGLHFSLREEQWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVY
GVKYYKSFRGETLGYTRFQGVYLPLLWEQSFCWKSPIALGYTRGHFSALVAMENDGYGNR
GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREWLDCCVTEGGV
LVAMQKSSRRRNHPLVTQMVEKWLDRYRQIRPCTSLSDGEEDEDDEDE
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgtcagaacatgggattaagtgggcctgtgaatattgtacgtatgaaaactggccgtct
gcaatcaagtgtactatgtgtcgtgcccagagacccagtggaacaattattacagaagat
ccatttaaaagtggttcaagtgatgttggtagagattgggatccttccagtactgaaggt
ggaagtagtcctttgatatgtccagactctagtgcaagaccaagggttaagtcttcatac
agcatggaaaatgcaaataaatggtcatgccacatgtgtacatatttgaactggccaaga
gcaatcagatgtacccagtgcttatcccagcgtaggaccaggagtcccacagaatctcct
caatcctcaggatctggttcaagaccagttgctttttctgttgatccttgtgaagaatac
aatgatagaaataaattgaatacaaggacccagcattggacttgttctgtttgcacatat
gaaaactgggctaaggctaaaaaatgtgttgtttgtgaccatcccagacctaataacatt
gaagcaatagagttggcagagactgaagaggcttcttcaataattaatgagcaagacaga
gctcgatggaggggaggctgcagtagtggtaatagccaaagaagatcacctccaactaca
aaacgggactcggaagtgaagatggattttcagaggatcgaattggctggtgctgttggt
accaaggaggaacttgaagtggactttaaaaaactaaagcagattaaaaataggatgaaa
aagactgattggctattcctcaatgcctgtgtgggtgttgtggaaggtgacttagcagcc
atagaagcatacaagtcatcgggaggagacattgcacgccagcttactgcagatgaagta
cgcttgctgaaccgtccttctgcttttgatgttggctacactctggtacatctggccata
cgctttcagaggcaggacatgttagcgatattgcttacagaggtatctcagcaagcagca
aagtgtattccagccatggtgtgtcctgaactgacagagcaaatccggagagaaatagct
gcttctcttcaccagagaaagggggattttgcttgctattttctgactgaccttgtaaca
tttacattaccagcagatattgaagatttgcctccaacagttcaagaaaaattatttgat
gaggtgcttgatagagatgttcaaaaagagctagaggaagaatctcccattataaactgg
tctttggagttggctacacgtctggacagtagactatatgcactttggaaccggactgcc
ggagattgtttacttgactcagtactacaagctacatggggcatttatgacaaagactcg
gtgcttcggaaagccctgcatgacagcctgcatgactgttcacattggttttacacacgc
tggaaagactgggaatcgtggtattcccagagctttggtttacatttttcactgagggaa
gaacaatggcaagaagactgggcattcatactctctctagctagtcagcctggagcaagt
ttggaacagacacacatttttgtacttgcacatattcttagacgaccaattatagtttat
ggagtaaaatattataagagtttccggggagaaactttaggatatactcggtttcaagga
gtttatctgcctttgttgtgggaacagagtttttgttggaaaagtccaatcgcactgggc
tatacaaggggccacttctctgctttggttgccatggagaacgatggctatggcaaccga
ggtgctggtgctaatctgaacactgatgatgatgtcaccatcacatttttgcctctggtt
gacagtgaaaggaagctcctccatgtgcacttcctgtctgctcaggagctaggtaatgag
gagcagcaagagaaactgctcagagagtggctggactgctgtgtgactgaagggggagtt
ctagtggccatgcagaaaagctctcggcggagaaaccaccccttggtcacacaaatggta
gaaaaatggcttgaccgctacagacagatccggccttgtacatccctgtctgatggagag
gaagatgaggatgatgaggatgaatga

DBGET integrated database retrieval system