KEGG   Mus musculus (house mouse): 378425
Entry
378425            CDS       T01002                                 
Symbol
Nlrp12, Nalp12, PYPAF7, monarch-1
Name
(RefSeq) NLR family, pyrin domain containing 12
  KO
K20865  NACHT, LRR and PYD domains-containing protein 12
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    378425 (Nlrp12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    378425 (Nlrp12)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   378425 (Nlrp12)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 LRR_6 PYRIN NOD2_WH FISNA AAA_16 AAA_25 NB-ARC WSLR nSTAND3
Other DBs
NCBI-GeneID: 378425
NCBI-ProteinID: NP_001028603
MGI: 2676630
Ensembl: ENSMUSG00000078817
Position
7:complement(3267317..3298400)
AA seq 1054 aa
MLPSTARDGLYRLSTYLEELEAGELKKFKLFLGIAEDLSQDKIPWGRMEKAGPLEMAQLM
VAHMGTREAWLLALSTFQRIHRKDLWERGQGEDLVRVTPNNGLCLFESQSACPLDVSPNA
PRKDLQTTYKDYVRRKFQLMEDRNARLGECVNLSNRYTRLLLVKEHSNPIWTQQKFVDVE
WERSRTRRHQTSPIQMETLFEPDEERPEPPHTVVLQGAAGMGKSMLAHKVMLDWADGRLF
QGRFDYVFYISCRELNRSHTQCSVQDLISSCWPERGISLEDLMQAPDRLLFIIDGFDKLH
PSFHDAQGPWCLCWEEKQPTEVLLGSLIRRLLLPQVSLLITTRPCALEKLHGLLEHPRHV
EILGFSEEARKEYFYRYFHNTGQASRVLSFLMDYEPLFTMCFVPMVSWVVCTCLKQQLES
GELLRQTPRTTTAVYMFYLLSLMQPKPGTPTFKVPANQRGLVSLAAEGLWNQKILFDEQD
LGKHGLDGADVSTFLNVNIFQKGIKCEKFYSFIHLSFQEFFAAMYCALNGREAVRRALAE
YGFSERNFLALTVHFLFGLLNEEMRCYLERNLGWSISPQVKEEVLAWIQNKAGSEGSTLQ
HGSLELLSCLYEVQEEDFIQQALSHFQVVVVRSISTKMEHMVCSFCARYCRSTEVLHLHG
SAYSTGMEDDPPEPSGVQTQSTYLQERNMLPDVYSAYLSAAVCTNSNLIELALYRNALGS
QGVRLLCQGLRHASCKLQNLRLKRCQISGSACQDLAAAVIANRNLIRLDLSDNSIGVPGL
ELLCEGLQHPRCRLQMIQLRKCLLEAAAGRSLASVLSNNSYLVELDLTGNPLEDSGLKLL
CQGLRHPVCRLRTLWLKICHLGQASCEDLASTLKMNQSLLELDLGLNDLGDSGVLLLCEG
LSHPDCKLQTLRLGICRLGSVACVGIASVLQVNTCLQELDLSFNDLGDRGLQLLGEGLRH
QTCRLQKLWLDNCGLTSKACEDLSSILGISQTLHELYLTNNALGDTGVCLLCKRLRHPGC
KLRVLWLFGMDLNKKTHRRMAALRVTKPYLDIGC
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgttgccgtctacagccagggatggcctctatcgactgtctacctacctggaagaactc
gaggctggggaactgaagaaattcaaattattcctggggattgcagaggacctgagccag
gacaaaattccctggggacgaatggagaaggctggtcctctggaaatggctcagctgatg
gtggcccacatggggacaagggaggcttggcttctggctctcagcacctttcagaggatt
cacaggaaggacctgtgggagcgaggacagggagaagacctggtgagggtcactccaaat
aatggtctatgcctttttgagagccaatcagcgtgccctttggatgtctctcccaatgct
ccaagaaaagatctacagacaacctacaaagactatgtccgaaggaaattccagctaatg
gaagaccgcaatgcacgattaggcgaatgtgtgaacctgagcaatcgttacactcggctt
ctcctagtaaaagaacactcaaatcctatctggacacagcagaaatttgtagatgtagag
tgggaacgctccagaaccaggcgtcaccagactagtcctatccaaatggagaccctcttt
gagccagacgaagaacgccccgagccaccacacacagtggtattacaaggggcagcgggg
atggggaagtccatgctggcccacaaagtgatgttggactgggccgatgggaggctcttc
caaggccggtttgattatgtcttctatatcagctgcagggagttgaatagaagccacacc
cagtgcagtgtacaagacctcatctccagctgctggccggagcgtggtatatccctcgaa
gacctcatgcaggctcctgaccgtctcctattcatcattgatggcttcgataaactccat
ccttctttccatgatgctcagggtccctggtgcctctgctgggaggagaaacaacctact
gaagtcctcctcggaagtctgattcggaggttgcttctgccccaggtctctctgctcatc
accacacgaccctgtgcactggagaagctgcacggcttgctagaacaccccaggcacgtg
gagatcctgggcttctccgaggaagctaggaaggaatatttctacagatatttccacaac
actggacaagcaagccgggtgttaagcttcttgatggactatgagcccctctttaccatg
tgttttgttcccatggtgtcctgggtggtctgcacctgcctaaagcagcagctggaaagt
ggggagcttttaagacaaacacctaggaccaccacagctgtttatatgttctaccttctg
agcctgatgcagcccaagccagggactccaaccttcaaagtcccagccaaccagagaggc
ctggtctctctggctgcagagggcctctggaatcagaagattctatttgatgaacaggat
cttgggaaacacggcctagatggagcagatgtgtccactttcctcaacgtgaacatattc
cagaagggtatcaaatgtgagaaattctacagcttcatccacctgagtttccaggaattc
ttcgcagccatgtactgtgcactgaatggcagagaggcggtgaggagagcgctggctgag
tatggtttttcggaaaggaacttcttggccctcacggtccactttctgtttggcctcctc
aacgaagagatgagatgctaccttgagaggaatctcggctggagcatctcccctcaggtg
aaggaggaagtgttggcatggatccaaaacaaggctgggagtgaaggctccaccctgcag
catggctccctggagctactcagctgcttgtatgaggtccaggaggaggacttcatccag
caggccctgagccactttcaagtggttgtagtcagaagcatctcaacaaagatggagcac
atggtctgctcgttttgtgcgaggtattgcagaagtacagaagtgcttcacttgcatggg
agtgcttatagtacaggcatggaggacgacccaccagaaccttcaggagtccagactcag
tccacatacttacaggaaaggaacatgctgcctgatgtctacagtgcatacctttcagca
gctgtctgtaccaactccaacctgatcgagctggccttataccgaaatgccttgggcagc
cagggtgtaaggctgctctgtcaaggcctccgacatgccagctgcaagctgcagaacctg
aggctgaagaggtgtcagatctccggatcagcctgccaggacctcgcagccgctgtcatc
gccaacaggaatttaatcaggctggacctcagtgacaacagcattggggtgccaggcctg
gagctgctctgtgaggggctgcagcaccccaggtgtaggctgcagatgatccagctgagg
aagtgtctgttggaggctgcagctggccgatccctggcttctgttctcagcaacaactca
tatctggtagaactggatctgacaggaaaccccttggaagattcggggctgaagttactg
tgtcaagggctaaggcaccctgtctgcaggctgcgtaccctgtggctgaagatctgccac
cttggacaagcttcctgcgaagatctggcctctactctcaaaatgaaccagagcctgctg
gagctggacctgggtctgaatgatcttggagattctggggtgcttctgctgtgtgaaggc
ctcagtcatccagattgcaaactccagacccttcggttgggcatttgccgactgggctca
gtcgcgtgtgtggggatcgccagtgtgctccaggtcaacacatgcctccaagagctggac
ctgagcttcaatgacttgggagacaggggcctgcagctgctgggggaaggcctgaggcac
cagacctgcagactccagaagctgtggctggacaactgcggactcacctccaaagcatgt
gaggacctttcttctatcctgggaatcagccagaccctgcatgagctttatttgaccaat
aatgctctgggggacacaggtgtctgtctgctgtgcaagaggctgaggcatccaggctgc
aagcttcgagtcctgtggctgtttgggatggacctgaataaaaagactcacaggaggatg
gcagcacttcgagtcacaaaaccgtacctggatattgggtgttga

DBGET integrated database retrieval system