KEGG   Mus musculus (mouse): 378430
Entry
378430            CDS       T01002                                 

Symbol
Nanos2, nos2
Name
(RefSeq) nanos C2HC-type zinc finger 2
  KO
K18760  protein nanos 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    378430 (Nanos2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     378430 (Nanos2)
SSDB
Motif
Pfam: zf-nanos zf-HIT
Other DBs
NCBI-GeneID: 378430
NCBI-ProteinID: NP_918953
MGI: 2676627
Ensembl: ENSMUSG00000051965
Vega: OTTMUSG00000058459
UniProt: P60322 I6ZHM2
Position
7; 7 A3
AA seq 136 aa
MDLPPFDMWRDYFNLSQVVMDIIQSRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTI
CNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCPLNSSQQS
LYRRSGRNSAGRRVKR
NT seq 411 nt   +upstreamnt  +downstreamnt
atggacctaccgccctttgacatgtggagagactactttaacctgagccaggtggtgatg
gatataattcagagccggaagcaaagacaggagggtgaggtagctgaggagcccaactcc
aggccccaggagaagagtgagcaggacctggagggctaccctggatgtctgcctaccata
tgcaacttctgcaagcacaatggggagtctcgtcacgtctacacctcacaccagctgaag
acgcctgaaggggtggttgtgtgtcccatcctgaggcactatgtgtgtcctctatgtgga
gccaccggcgaccaggctcatacactcaagtattgtccactcaacagcagtcagcagtct
ctctaccgacgcagtgggcgaaactcagctggtcgcagagtcaagcgataa

DBGET integrated database retrieval system