KEGG   Mus musculus (mouse): 378431
Entry
378431            CDS       T01002                                 

Symbol
Txlnb, 2310001N14Rik, Mdp77
Name
(RefSeq) taxilin beta
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Taxilin
Other DBs
NCBI-GeneID: 378431
NCBI-ProteinID: NP_619534
MGI: 2671945
Ensembl: ENSMUSG00000039891
Vega: OTTMUSG00000042108
UniProt: Q8VBT1
Position
10:17671967..17721411
AA seq 685 aa
MEINHPDQLSVEHPTPPGDSSSLNQNGPGKQDGERCSTSGQAPEQEGSLHPEKGAHDVAE
ELSRQLEDIISTYGSAASPRGKESTSETKEQPPNTEAPDNEDVDYEETTEEIDREPTAPE
EPAAAKEPVSNKEQKLEKKILKGLGKEANLLMQNLNKLQAPEEKLDFLFKKYTELLDEHR
TEQKKLKLLLKQQAQTQREKDQLQSEHNRAVLARSKLESLCRELQRHNKTLKEETLQRAR
EEEEKRKEITSHFQTTLTDIQTQIEQQSERNMKLCQENTELAEKLKSIIDQYELREEHLD
KIFKHRELQQKLVDAKLEEAQELMQEAEERHRREKEYLLNQAAEWKLQAKVLKEQETVLQ
AQLTLYSGRFEEFQSTLTKSNEVFATFKQEMDKTTKKMKKLEKDTATWKARFENCNKALL
DMIEEKALRAKEYECFVMKIQRLENLCRALQEERKELYKKIREAKMSEKEDQVQRTSEEE
PEPSVSENEEVDAEEANSFQKAVENLATAFTILHHPEFTPDQPTERQLAVNGPQSGSDVT
HQHPETARLNHPSLPADSGSPRPPVGAQAVAEGVCEATPAPTASCTPAEAELQSQGLPAE
NTPGPKPHKPEANTSGQAPLSPAQGSLSVVEAKYDISPSPESEGDSAVVPGCESREQPPP
EVTDIPVGPSTGLPREPDACLNGVD
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggagattaatcatcctgatcagctctcagtggagcacccaactcccccaggggacagc
tcatcactcaatcaaaacggcccgggaaagcaagatggcgagcggtgctcaacctcaggc
caagcgccagagcaagagggaagcctgcatcccgagaagggagcccatgatgtcgcggaa
gagttgagcaggcaactggaagacatcataagcacgtatgggtctgctgccagtccccga
gggaaggagagcacctctgaaactaaggagcagcccccaaacacagaggcaccagacaat
gaggatgttgactatgaagaaaccactgaagagatagacagagaacccactgctcctgaa
gagccagccgcagccaaagagcctgtcagcaataaagagcaaaagctggaaaagaaaatc
ttaaaaggattaggtaaagaagctaacttgctcatgcaaaacctgaacaagctgcaagca
cctgaagaaaagcttgattttttattcaagaagtatactgaattgctggatgaacatcgc
accgagcaaaagaaactgaagctcctactgaaacagcaggcgcagacccagagagagaag
gaccagttgcagagtgagcacaacagagccgtccttgctcgaagcaaactcgagagtctg
tgtcgggagctacagaggcacaacaagacgctgaaggaagaaaccctccaacgggcgcgc
gaggaagaagagaagaggaaagagatcacaagtcactttcaaactaccctgacagatatc
cagactcagatcgaacaacagagtgagcgcaatatgaagctctgccaggagaacacagag
cttgcagaaaaactgaaaagcatcattgaccagtacgagctcagagaggagcatctggac
aaaatattcaaacatcgagaactgcagcagaagctggtggatgcgaaacttgaagaggct
caagaactgatgcaggaggcagaggagcggcacagacgggagaaggaatatttgctgaac
caggcggcagagtggaaacttcaggccaaagtgctgaaggagcaggagacggtgctgcag
gctcagctcactctctactcaggaaggtttgaggagttccagagtacactgacaaaaagc
aatgaagtgtttgccactttcaagcaggaaatggataagacaactaagaaaatgaagaag
ctggagaaggacaccgccacgtggaaagcccgatttgagaattgtaacaaagccctgttg
gacatgatcgaagagaaagccctgcgagctaaagaatacgagtgtttcgtgatgaaaatc
caaaggctggagaacctgtgtcgtgctttacaagaggagagaaaggaactctacaagaaa
atcagagaagcaaaaatgtccgaaaaggaagaccaggttcagcgcacctctgaggaagag
ccagagccaagcgtctctgaaaatgaagaggtggacgcagaggaagccaacagttttcaa
aaagctgtggaaaacctggccacagcttttaccatccttcatcatccagagttcacccca
gaccaaccaacggaaagacagctggcagtgaatggtcctcaaagtggaagtgatgtcacc
caccagcaccccgaaacagcccgtttaaaccatcccagccttcccgctgattcagggagt
cctcggccccctgtaggtgctcaggctgtggcggagggcgtctgtgaggccacacctgcc
cctacagcctcctgtacccctgcagaggcagagctacaaagtcagggtctccctgcagaa
aataccccgggtccgaagccccataaaccagaggcaaacacttctggtcaggccccactg
tccccagcccagggctccctatctgtagtagaggcaaaatatgatatttcaccatctcca
gagagtgagggagattctgctgtggtgcccggctgtgagtctagggagcagcccccacca
gaagtcacagacatccccgtaggcccttccactggactccccagagagcccgatgcttgt
ctgaatggagtagactaa

DBGET integrated database retrieval system