KEGG   Mus musculus (mouse): 378435
Entry
378435            CDS       T01002                                 

Gene name
Mafa, RIPE, RIPE3b1
Definition
(RefSeq) v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian)
  KO
K07595  transcription factor MAFA
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04930  Type II diabetes mellitus
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    378435 (Mafa)
   04950 Maturity onset diabetes of the young
    378435 (Mafa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    378435 (Mafa)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    378435 (Mafa)
SSDB
Motif
Pfam: bZIP_Maf Maf_N bZIP_1 KASH_CCD FapA
Other DBs
NCBI-GeneID: 378435
NCBI-ProteinID: NP_919331
MGI: 2673307
Ensembl: ENSMUSG00000047591
UniProt: Q8CF90
Position
15; 15 D3
AA seq 359 aa
MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCS
SVPSSPSFCAPSPGTGGGAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGY
QHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGQSFAGGGGADDMGA
GHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGHGGGGAGHHVRLEERFSDDQLVS
MSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVE
QLKLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAKGAPDFFL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggccgcggagctggcgatgggcgcagagctgcccagcagcccactggccatcgagtac
gtcaacgacttcgacctgatgaagttcgaggtgaagaaggagccgcccgaggccgagcgc
ttctgccaccgcctgccgcccggctcgctgtcctcgacgcccctcagcacgccctgctcc
tcggtgccctcttcgcccagcttctgcgcacccagcccgggcacaggcggcggcgcgggc
ggcgggggcagcgcggctcaggccgggggcgccccggggccgccgagtggaggccccggc
actgtcgggggcgcctcaggaaaagcggtgctggaggatctgtactggatgagcgggtac
cagcaccacctgaaccccgaggcgctcaacctgacgccggaggacgcggtggaggcgctc
atcggcagcggccaccacggcgcgcaccacggcgcgcatcacccggcggctgctgcggcc
tatgaggccttccggggtcagagcttcgcgggcggcggcggcgcggacgacatgggtgcc
ggccaccaccacggcgcacaccacactgcccaccatcatcactctgcccaccatcaccat
caccaccatcaccaccacggaggctctggccaccacggcggaggcgcgggtcacggcgga
ggcggcgcaggccaccacgtgcgcttggaggagcgcttctccgacgaccagctggtatcc
atgtccgtgcgggagctgaaccggcagctccgcggcttcagcaaggaggaggtcatccga
ctgaaacagaagcggcgcacgctcaagaaccgcggctacgcgcagtcgtgccgcttcaag
cgggtgcagcagcggcacattctggagagcgagaagtgccagctccagagccaggtggag
cagctgaagctggaggtggggcgtctggccaaggagcgggacctgtacaaggagaaatac
gagaagttggcgggccggggcggccccgggggcgcgggcggggccggcttccctcgggag
ccctcgccagcgcaggctggccccggggcggccaaaggcgcacccgacttctttctgtga

DBGET integrated database retrieval system