KEGG   Mus musculus (mouse): 380614
Entry
380614            CDS       T01002                                 

Gene name
Intu, 9230116I04Rik, 9430087H23Rik, Pdzd, Pdzd6, Pdzk, Pdzk6, mKIAA1284
Definition
(RefSeq) inturned planar cell polarity protein
  KO
K22862  protein inturned
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    380614 (Intu)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    380614 (Intu)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   CPLANE complex
    380614 (Intu)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   380614 (Intu)
SSDB
Motif
Pfam: Intu_longin_2 Intu_longin_3 Intu_longin_1 PDZ_6 PDZ
Other DBs
NCBI-GeneID: 380614
NCBI-ProteinID: NP_780724
MGI: 2443752
Ensembl: ENSMUSG00000060798
Vega: OTTMUSG00000030600
UniProt: Q059U7
Position
3; 3 B
AA seq 942 aa
MAGLARGDSRGRPPELPGDLSSQEEEEEEGDSDAGASSLGSYSSASSDTDVEPEWLDSVQ
KNGELFYLELSEDEEESLLPETQTANHVNHVRFSDKEVIIEEDDSRERKKSEPKLRRFTK
ILKSKSLLPRRHHKKSSSNNGPVSILKHQSSQKTGVTVQQRYKDVTVYINPRKLTAIKAR
EQVKLLEVLVGIIHQTKRSWKRSAKQADGERLVVHGLLPGGSAMKSGQVLVGDVLVAVND
VDVTSENIERVLSCIPGPMQVKLTFENAYAVKRETAQPQKKKAQSSTQDLVKLLCGSEAD
AVQHSTLSIPHISMYLTLQLQSEAAREEQEILYHYPVSEASQKLKSVRGIFLTLCDMLES
VTGTQVTSSSLHLNGKQIHVAYLKESDKLLLIGLPAEEVPLPQLRNMIEDVAQTLKFMYG
SLDSAFCQVENAPRLDHFFSLFFERALRPGKLHLSGSPSAQQYAAASAVLLDNLPGVRWL
VLPQELKVELDTALSDLEAADFEELSEDYYDMRRLYTILGSSLFYKGYMVCSHLPKDDVI
EIAAYCRQHCLLPLAAKQRIGQLIIWREVFPRHHLQPPSDSDPEAFQEPEGRYFLLVVGL
RHYLLCVLLEAGGCASKATGNPGPDCIYVDQVRATLHQLEGVDSRIEEQLATSPGPCLSC
ADWFLAAPREKADSLTTSPILSRLQGPSKTAASPTCRRTFFSDYSFKARKPSPSRIGGGR
EPTEGEESAGLSPHATPDAVRKQRESEGSDDNVALLKLARKKSTLPNPFHLGTSKKELSE
KELEVYDIMKLTSGPENTLFHYVALETVQGIFITPTHEEVAQLGGSVHSQLIKNFHQCCL
SIRAFFQQTLKEEKKKALSDGEHSEPTNSVSSLSPVKEHGVLFECSPENWTDQKKTPPVM
SYWVVGRLFLNPKPQELYVCFHDSVSEIAIEMAFKLFFGLTL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggcgggccttgcgaggggagactcgcgtgggcgcccgcccgagctccctggagacctg
tcctcacaggaagaggaagaggaggaaggcgactccgacgccggggccagcagcttgggc
tcctactcctcagccagcagtgacactgatgtggagcctgagtggctggacagtgtgcag
aagaacggagaactgttctacctggagctgagtgaggacgaggaggagagcctccttccg
gagacccagacagcgaaccacgtgaaccacgtgaggttcagcgacaaggaggtcatcatc
gaagaggacgattccagagagaggaagaagtccgagcccaagctcaggcgcttcaccaag
atcttgaaaagcaaaagccttttacccaggcgtcaccacaaaaagagcagcagcaacaat
gggcccgtgtccattctgaaacatcagtcctcccagaagacgggagtcaccgtgcagcag
cggtacaaggatgtgaccgtctacatcaaccccagaaagctgacggccatcaaggccagg
gagcaggtcaaactcctggaagtactggtggggatcatccatcagaccaagaggagctgg
aaaaggagcgcgaagcaggcagacggagagaggctcgtggtgcatggcctgttgccagga
ggctcggctatgaagagcggtcaggtcctggttggcgatgtccttgttgctgtgaatgat
gtagatgtgacttctgaaaacatagaaagagttctgtcctgcatccctgggccaatgcag
gtgaagctgacatttgaaaacgcatatgctgtgaaacgggaaacagctcaaccccaaaag
aaaaaggcacagtcgagcacccaagatttggtgaaactcctctgcgggtcagaggctgat
gctgtccagcacagtaccctgagcatcccacacatctccatgtacctcacactgcagctc
cagtcagaggcagccagggaggagcaggaaattctttaccattatccagtgtctgaagca
tctcagaaactcaagagcgtgagggggatttttctcacgctctgtgacatgctggaaagc
gtaacggggacacaagtcactagctcatccctccatctaaatgggaaacaaattcatgtt
gcttacttgaaagagtctgacaagttgctgttaattggcctgcctgctgaagaagttcct
cttcctcagttaaggaacatgatagaagatgtggcccaaaccctaaagttcatgtatggt
tctttagacagcgccttctgccaggttgagaacgcacctcgtctggatcatttcttcagt
ttgttcttcgaacgagctcttcggcccggcaagttgcatctcagcggcagccccagcgcc
cagcagtatgccgcagccagtgccgtgcttttggacaatctcccgggagtccgttggctc
gtgcttccacaggaactcaaggtggaactggacacagcactgagtgaccttgaggccgct
gacttcgaagaactgtctgaggattattatgacatgagacggctgtatacaattttgggt
tcttctctgttttacaagggttacatggtgtgcagccatctgcctaaggatgatgttatt
gagatcgctgcatactgtcgccagcactgcctgctgcctttagcagcaaagcaaaggatt
ggccagctgataatatggagagaggtgttcccaagacaccacctccagcccccttcagac
tcagaccccgaggccttccaggaacctgaagggagatatttcttactagttgtcggattg
cgacattatttgttgtgcgtgctgttagaagctggaggctgtgcatctaaagctactggg
aaccctggtcccgattgtatctatgtagatcaggtcagagcgacccttcatcagctggaa
ggagtagactcccgcatagaggaacagctagccacatccccggggccctgcttgtcttgt
gctgactggttccttgctgctccacgtgaaaaggcagatagtttgactacttcacctatc
ctcagtcggctgcaggggccttccaaaacagcagcctctccaacatgcaggagaaccttt
ttcagtgactattccttcaaggcacggaagcccagtccctccaggatcggtggaggacgt
gaacccactgaaggggaagaaagtgctggtctgagcccacatgctaccccagatgcagta
cggaagcaaagagaatccgaaggctcggacgacaatgtggccttgcttaagcttgctaga
aagaagtcaacacttccaaatccgtttcatttgggaacttcgaaaaaagaactttcagaa
aaagagttggaagtctatgacataatgaaattgacctccggtcctgagaatacactcttc
cactatgttgccttggaaacagtgcaaggcatcttcatcacccccacccatgaagaggtg
gctcagctaggtggttccgttcactctcaactgataaagaatttccatcaatgttgtctc
tctatccgtgcatttttccagcagacgctgaaggaagagaaaaagaaagcgctaagtgat
ggagagcattcggagcctacaaattcagtgtcttctctgagccctgtgaaagaacatggt
gtgctgtttgaatgctcacctgaaaactggactgatcagaaaaagactccaccagtcatg
tcatactgggtagtagggcggctctttcttaacccaaaacctcaggaactatatgtctgt
tttcacgactcagtctcagaaattgccattgaaatggcatttaaattgttctttgggtta
acgttgtag

DBGET integrated database retrieval system