KEGG   Mus musculus (mouse): 380660Help
Entry
380660            CDS       T01002                                 

Gene name
Acss3, 8430416H19Rik, Gm874
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 3
  KO
K01908  propionyl-CoA synthetase [EC:6.2.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    380660 (Acss3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    380660 (Acss3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.17  propionate---CoA ligase
     380660 (Acss3)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   380660 (Acss3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 380660
NCBI-ProteinID: NP_001136276
MGI: 2685720
Ensembl: ENSMUSG00000035948
Vega: OTTMUSG00000023051
UniProt: Q14DH7
Position
10; 10 D1
AA seq 682 aa AA seqDB search
MKPSWLQCRKVTGAGTLGAPLPGSPSVRGAAVTRRALVAGFGGRGCRALTTGSGGEYKTH
FAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQ
GDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIPQAIYTM
LACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIG
QHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGL
PKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLY
EGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAG
ERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPGYNVM
ILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDE
EGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLK
KDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYK
VTPTIEDPSIFGHIEEVLKQAV
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatcctggttgcaatgtcgcaaagtaacaggcgccgggacgcttggggcacct
ctgccaggatccccttcagtaagaggagccgctgtgacccgaagggctttggtggccggg
tttgggggcaggggctgcagggctctgaccaccggcagtggtggtgagtacaagacccac
ttcgcagcctctgtggctgaccccgaaagattctggggtaaagctgctgagcagatcagt
tggtacaagccctggaccaaaactctagagagcagatacccgccttccacaagttggttt
gtggaagggatgctgaacatttgttacaatgctattgatcggcacattgaaaatggccaa
ggggataagattgctatcatctatgacagtcccgttacagacaccaaagcaactatctcc
tataaggaagtcttggagcaggtctctaagctggctggtgtcttggtcaagcagggtgtc
aagaaaggcgatacagtggtcatctatatgcccatgatcccacaagcaatatataccatg
ctggcgtgtgcaaggataggagcaatccacagtctcatatttggaggatttgcatccaaa
gaattaagtacgcgcattgatcatgcgaagcctaaggtggttgttacggcatcatttggc
attgaaccaggaaggaaggtggagtacatcccacttctagaagaagctctgaggatagga
cagcacaggccagacagagttctcatttacagccgtccaaacatggagaaagttcctttg
atgtcaggtcgtgatcttgattgggaagaagaaatggcaaaagcccagtctcatgactgc
gtgcctgttctctcagagcatccattgtacattctctacacatctggaacaactgggctg
cctaagggtgtggttagacccactgggggctatgctgtcatgttgaactggacaatgtct
tccatatatggactcaaacctggagaggtatggtgggcagcttctgacttaggctgggtt
gttggacattcctatatttgctatgggcctcttctccatggaaacacaacagttttatat
gagggaaagcctgtgggaacaccggatgctggcgcttatttccgtgtgcttgcagagcat
ggagtggctgccttgtttacagcaccaactgcaattagagccatccgtcaacaggaccct
ggggcagccttggggaagcagtactctctgacaaggttcaagacactgtttgtagctggg
gaaagatgtgatgtggagaccctagaatggtccaaaaaagtcttccgagttcccgttcta
gaccattggtggcaaacagagactggatcccccatcacagcatcatgtattggattaggt
aactccaaaacacctccaccaggacaagcaggaaaatgtgttccaggatacaatgttatg
attttggatgacaacatgcaaaaactgaaggctagaagcttaggaaacattgtggtaaag
ttgccattaccacctggggctttttcaggactctggaagaaccaggaagcattcaagcat
ttatactttgagaaatttcctggatactatgacactatggatgccggctacatggatgag
gaaggctacctatatgtgatgtcccgagtggatgatgtcataaacgttgcaggccacagg
atttctgcaggcgctattgaggagtcagtcctctcacacggcactgtggctgactgcgct
gtggttggcaaggaagaccccttgaaaggtcacgtccccttagcactctgcgtgttgaag
aaagacgtaaatgcatcagaagaacaagttttggaagagattgtgaaacatgttaggcag
agcattggccctgtggctgcttttcgaaatgcggttttcgtcaaacagttacccaaaacc
aggtctggcaaaattccacggtctacactgtctgccctggttaatggcaagccttataag
gtgacccctacgattgaggaccccagcatttttggtcacattgaagaagtgctgaagcag
gctgtgtga

DBGET integrated database retrieval system