KEGG   Mus musculus (house mouse): 380669
Entry
380669            CDS       T01002                                 
Symbol
Lin28b, 2810403D23Rik, D030047M17Rik, Lin-28.2
Name
(RefSeq) lin-28 homolog B
  KO
K18754  protein lin-28
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    380669 (Lin28b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     380669 (Lin28b)
SSDB
Motif
Pfam: CSD zf-CCHC
Other DBs
NCBI-GeneID: 380669
NCBI-ProteinID: NP_001026942
MGI: 3584032
Ensembl: ENSMUSG00000063804
UniProt: Q45KJ6
Position
10:complement(45252713..45362410)
AA seq 271 aa
MAEGGASKGEEPEKLPGLAEDEPQVLHGTGHCKWFNVRMGFGFISMISREGNPLDIPVDV
FVHQSKLFMEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPGGSPCLGSERRPKGKTLQKR
KPKGDRWRRQDLLMDQMWTVREEESRMIPRCYNCGGLDHHAKECSLPPQPKKCHYCQSIM
HMVANCPHKLAAQLPASSQGRQEAESQPCSSAAPREVGGGHGCTVLFPQEVKSEMAEHSD
RSPQEVSSTKAFAAIGEQNKKGPLIQKRKKT
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccgaaggcggggcaagcaaaggtgaagagccagaaaaactgcccgggctggcagag
gacgaaccccaggttctgcatggcactggccactgtaaatggttcaacgtgcgcatggga
ttcggattcatctccatgataagtcgagagggaaatcccttggatattccagtggatgta
tttgtacaccaaagcaaactattcatggaaggatttagaagcttgaaagaaggagagcca
gtggaatttacatttaaaaaatcccccaaaggccttgagtcaatacgggtaacaggccca
ggtgggagcccctgcttaggaagtgaaagaagacctaaagggaagaccctgcaaaagaga
aagccaaagggagataggtggagacggcaggatttactgatggatcagatgtggactgtg
cgagaagaagagtccaggatgattccaagatgctacaactgtggtggtctcgaccatcat
gctaaagaatgcagtctacctcctcagccaaagaagtgccattactgtcagagcatcatg
cacatggtggccaactgcccacacaagcttgccgctcagctgcccgccagttctcaggga
agacaggaggcagaatcccagccatgcagctctgcggcaccaagagaagtgggagggggg
catggctgcacagtactgtttcctcaggaggtgaagtcagaaatggcagagcactcagac
aggtcaccccaagaagtttcttccacgaaagcgtttgcagcaataggagagcaaaacaaa
aaggggcctttgattcagaaacggaaaaagacttag

DBGET integrated database retrieval system