KEGG   Mus musculus (mouse): 380701Help
Entry
380701            CDS       T01002                                 

Gene name
Slc47a2, 4933429E10Rik
Definition
(RefSeq) solute carrier family 47, member 2
  KO
K03327  multidrug resistance protein, MATE family
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    380701 (Slc47a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   380701 (Slc47a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MatE Polysacc_synt_C DUF3341
Motif
Other DBs
NCBI-GeneID: 380701
NCBI-ProteinID: NP_001028714
MGI: 3588190
Ensembl: ENSMUSG00000069855
Vega: OTTMUSG00000005830
UniProt: Q3V050
Position
11; 11 B2
AA seq 573 aa AA seqDB search
MEPAEDSLGATIQPPELVRVPRGRSLRILLGLRGALSPDVRREAAALVALAGPVFLAQLM
IFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKR
VGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPAAFLF
QLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALL
FLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTE
LGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVG
ILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVL
NTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQAQV
RAGLKSTKELIPTPADLPILEREVMDGVILPDIIRPESQTGQLVVEENSQCAVPTVGEVL
TGRQLVFYRGMALTVSVAVLIAGIVVRVFNDRG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggagccggccgaggacagcctgggagccaccatccagcccccggagctggtccgcgtc
ccacgggggcgcagtctgaggatcctgctgggccttcgaggagcgctgtcccccgacgtg
agacgggaggcggccgcgctagtggcgctcgcgggcccggtgttcctggcgcagctgatg
atctttctcatcagcatcgtcagttccatcttctgcggacacctgggcaaagtcgagttg
gacgccgtgacactcgctgtttccgttgtgaatgtcactggaatttcagtagggactggc
ttggcctcggcttgtgacacactgatgtctcagtcctttggaggcaagaacttgaagcgc
gtgggggtcatactccaaaggggcatcctcatcctgctgctctgctgcttcccatgctgg
gccatcttcctcaacaccgagcgcctgctgctgctcctaaggcaggacccggatgtcgcc
aggctagcccaggtttatgtgatgatatgcatccctgctcttcctgcagcgttcctattc
cagctgcagacgcggtatttacagagccagggcatcattatgccccaagttattgttggg
atcgcagcaaatgtcgtcaacgtgggcatgaacgccttcttgctgtatgccttggacctc
ggagtggtagggtcggcctgggccaacaccacctctcagttcttcctgtctgccctgctt
ttcctctacgtgtggtggaagagaatccacatccacacttggggagggtggacaagggag
tgcttccaggagtggagctcctacacgcgcctggccatccccagtatgttcatggtgtgc
atcgagtggtggaccttcgagattgggaccttccttgcaggccttgttaatgtgacagaa
ctgggagcccaggccgtcatctatgaactggcttctgtcgcctacatggtgccctttggc
tttggtgtggctgccagcgtccgagtgggcaatgctctgggggcagggaacgctgaccag
gcccggtgttcctgtaccactgttcttctgtgtgctggtgtctgtgcactcctggtgggg
attctgctcgcagccttgaaggatgtggttgcctacatcttcaccaatgacaaggacatc
atttcccttgtgagtcaagtgatgcccatttttgctccctttcatctctttgatgcactt
gcgggcacctgtggcggggtcctgagaggcacgggaaaacaaaagataggcgctgtcctg
aacactatcggttactacgggtttggttttcctattggagtgtccctgatgtttgctgct
aagcttgggataataggcctctgggctggactgatagtctgtgtctccttccaagccttc
tcctatttaatctacatcctgaggacaaactggagcagagtcgcagagcaggcacaagtt
cgagctgggctaaaaagcaccaaggagttgatacccacgccagcagatctgcccatcttg
gaaagagaagttatggatggagtgattttgcctgatatcatcaggccagagagtcagacc
ggccagctggtggtggaagagaacagccagtgtgcagtgcccaccgttggggaggtcttg
acggggagacagctggttttctatcgtgggatggctctgactgtttctgttgctgtcctc
atagcagggattgtggtgcgagttttcaatgaccgtggctaa

DBGET integrated database retrieval system