KEGG   Mus musculus (house mouse): 380701
Entry
380701            CDS       T01002                                 
Symbol
Slc47a2, 4933429E10Rik
Name
(RefSeq) solute carrier family 47, member 2
  KO
K03327  multidrug resistance protein, MATE family
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    380701 (Slc47a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   380701 (Slc47a2)
SSDB
Motif
Pfam: MatE Polysacc_synt_C
Other DBs
NCBI-GeneID: 380701
NCBI-ProteinID: NP_001028714
MGI: 3588190
Ensembl: ENSMUSG00000069855
UniProt: Q3V050
Position
11:complement(61192453..61233686)
AA seq 573 aa
MEPAEDSLGATIQPPELVRVPRGRSLRILLGLRGALSPDVRREAAALVALAGPVFLAQLM
IFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKR
VGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPAAFLF
QLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALL
FLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTE
LGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVG
ILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVL
NTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQAQV
RAGLKSTKELIPTPADLPILEREVMDGVILPDIIRPESQTGQLVVEENSQCAVPTVGEVL
TGRQLVFYRGMALTVSVAVLIAGIVVRVFNDRG
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggagccggccgaggacagcctgggagccaccatccagcccccggagctggtccgcgtc
ccacgggggcgcagtctgaggatcctgctgggccttcgaggagcgctgtcccccgacgtg
agacgggaggcggccgcgctagtggcgctcgcgggcccggtgttcctggcgcagctgatg
atctttctcatcagcatcgtcagttccatcttctgcggacacctgggcaaagtcgagttg
gacgccgtgacactcgctgtttccgttgtgaatgtcactggaatttcagtagggactggc
ttggcctcggcttgtgacacactgatgtctcagtcctttggaggcaagaacttgaagcgc
gtgggggtcatactccaaaggggcatcctcatcctgctgctctgctgcttcccatgctgg
gccatcttcctcaacaccgagcgcctgctgctgctcctaaggcaggacccggatgtcgcc
aggctagcccaggtttatgtgatgatatgcatccctgctcttcctgcagcgttcctattc
cagctgcagacgcggtatttacagagccagggcatcattatgccccaagttattgttggg
atcgcagcaaatgtcgtcaacgtgggcatgaacgccttcttgctgtatgccttggacctc
ggagtggtagggtcggcctgggccaacaccacctctcagttcttcctgtctgccctgctt
ttcctctacgtgtggtggaagagaatccacatccacacttggggagggtggacaagggag
tgcttccaggagtggagctcctacacgcgcctggccatccccagtatgttcatggtgtgc
atcgagtggtggaccttcgagattgggaccttccttgcaggccttgttaatgtgacagaa
ctgggagcccaggccgtcatctatgaactggcttctgtcgcctacatggtgccctttggc
tttggtgtggctgccagcgtccgagtgggcaatgctctgggggcagggaacgctgaccag
gcccggtgttcctgtaccactgttcttctgtgtgctggtgtctgtgcactcctggtgggg
attctgctcgcagccttgaaggatgtggttgcctacatcttcaccaatgacaaggacatc
atttcccttgtgagtcaagtgatgcccatttttgctccctttcatctctttgatgcactt
gcgggcacctgtggcggggtcctgagaggcacgggaaaacaaaagataggcgctgtcctg
aacactatcggttactacgggtttggttttcctattggagtgtccctgatgtttgctgct
aagcttgggataataggcctctgggctggactgatagtctgtgtctccttccaagccttc
tcctatttaatctacatcctgaggacaaactggagcagagtcgcagagcaggcacaagtt
cgagctgggctaaaaagcaccaaggagttgatacccacgccagcagatctgcccatcttg
gaaagagaagttatggatggagtgattttgcctgatatcatcaggccagagagtcagacc
ggccagctggtggtggaagagaacagccagtgtgcagtgcccaccgttggggaggtcttg
acggggagacagctggttttctatcgtgggatggctctgactgtttctgttgctgtcctc
atagcagggattgtggtgcgagttttcaatgaccgtggctaa

DBGET integrated database retrieval system