KEGG   Mus musculus (house mouse): 380712
Entry
380712            CDS       T01002                                 
Symbol
Tlcd2
Name
(RefSeq) TLC domain containing 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8
Other DBs
NCBI-GeneID: 380712
NCBI-ProteinID: NP_081525
MGI: 1917141
Ensembl: ENSMUSG00000038217
Position
11:75358771..75361725
AA seq 310 aa
MASWGLLVAGASFTAFRGLHWGLQLLPTPKSVRDRWMWRNIFVSLIHSLLSGVGALVGLW
QFPQMVTDPINDHPPWARVLVAVSVGYFAADGVDMLWNQTLAQAWDLLCHHLAVVSCLST
AVVSGHYVGFSMVSLLLELNSICLHLRKLLLLSHKAPSLAFRVSSWASLATLVLFRLLPL
GWMSLWLSRQHYQLSLALVLLCVAGLVTVGSISISTGIRILTKDILQSQPYPFILMHKET
KTREPVARNTSTLSLKGSRYLYSTAAAALGGHLMVLASPKRCMTPSVLGLQERRLEPGKV
AHADNASTWE
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcatcctggggactccttgtggctggcgcttccttcacggcgtttcggggactgcac
tgggggctgcagctgctgcccaccccgaaatctgttcgggaccgctggatgtggcggaac
attttcgtttcgctgatacacagcctactctctggagtaggggcgctggtcgggctgtgg
cagtttcctcaaatggtcaccgacccaattaatgatcacccaccgtgggcacgggtccta
gtagcagtgtcagtgggttatttcgctgcagatggagttgatatgctgtggaaccagaca
ttggcccaggcctgggaccttctctgtcaccatttggcggtagtgagctgcctcagcacc
gctgttgtgtctggccactatgtgggcttctctatggtatccctgcttctggagctgaac
tccatctgtttgcatctacggaagctactgctgctctcccataaggccccatccttggcc
ttcagagtaagcagttgggccagcctggccaccctggtcctcttccgccttctgcctctg
ggatggatgagtctgtggttgtcccggcagcactaccagctgtctcttgctctggttctg
ctttgtgtggctgggctggtcaccgtgggcagcataagcatctccacagggatccgaatt
ctgaccaaggatatcttgcagtctcagccctacccgtttatcctcatgcacaaggaaacc
aagacacgtgagcctgttgccaggaacacttccactctcagtctgaaaggctccagatac
ctgtactccactgctgctgctgctcttggtggtcatctcatggtactggcatctccaaaa
cgctgcatgaccccttcagtcctgggccttcaagagagaagactagagcctggcaaagtg
gcacatgctgataatgctagcacttgggaatga

DBGET integrated database retrieval system