KEGG   Mus musculus (house mouse): 380714
Entry
380714            CDS       T01002                                 
Symbol
Rph3al, Gm1753, Noc2
Name
(RefSeq) rabphilin 3A-like (without C2 domains)
  KO
K19939  Rab effector Noc2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    380714 (Rph3al)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    380714 (Rph3al)
SSDB
Motif
Pfam: FYVE_2 zf-piccolo IBR zf-B_box PHD
Other DBs
NCBI-GeneID: 380714
NCBI-ProteinID: NP_083824
MGI: 1923492
Ensembl: ENSMUSG00000020847
UniProt: Q768S4
Position
11:complement(75721818..75858440)
AA seq 302 aa
MADTIFSSGNDQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRRSQCLSPGELEIILQVIQ
RAERLDILEQQRIGRLVERLETMQRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKKVC
TKCGIEASPGQKRPLWLCKICSEQREVWKRSGAWFYKGLPKYILPLKTPGRADDPHFRPL
PVEPTETQPPSAETSRVYTWARGRVVSSDSDSDSDLSSSSLEDRPLPSGVKGTKGDKPRG
DSGASMESPRLGPARPPSHLSGSQSSLGSEAGTGATEPQGGTPAQPEPRVPGKRHTWATP
RY
NT seq 909 nt   +upstreamnt  +downstreamnt
atggctgacaccatcttcagcagtggaaatgatcagtgggtttgccccaacgatcggcag
cttgctctgagagccaagctgcagacgggctggtctgtgcacacgtaccagacggagaag
cagaggaggagccagtgcctgagccccggagagctggagatcatccttcaggtcatccag
agagcagagaggctagacatcctggagcagcagagaattgggcggctggtggagcggctg
gagacaatgcagaggaacgtgatgggcaacggtctctcccagtgtctgctctgcggggag
gtgctgggattcctgggcagctcctccgtattctgcaaagactgcaggaagaaagtctgc
accaagtgtgggatcgaggcttcccccggccagaagcggcccctgtggctgtgtaagatc
tgcagtgagcagagagaggtctggaagaggtcaggggcctggttctacaaagggctcccc
aagtacatcttgcccctgaaaacccctggccgggctgatgatccccacttccgacctctg
cctgtggagcccacagaaacacagcctccgagtgctgaaaccagccgtgtctacacatgg
gcccgagggagagtggtttccagtgacagtgacagtgactcagatctcagctcctccagc
ctggaggacagacccttgccctctggggtcaagggcacaaaaggtgacaagcctagaggg
gactcaggtgccagcatggagtcacccaggctggggcctgcccgtccacccagccatctc
tcgggcagtcagagcagcctaggcagtgaggctgggacaggtgctacagagccacaggga
ggcaccccagcccagcctgagcccagggtacccggcaaaagacacacatgggcaactccc
cgctactga

DBGET integrated database retrieval system