KEGG   Mus musculus (mouse): 380732
Entry
380732            CDS       T01002                                 

Gene name
Milr1, Alle, Allergin-1, Gm885, Mca32
Definition
(RefSeq) mast cell immunoglobulin like receptor 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig I-set SIT DUF4059 Cytomega_UL20A
Other DBs
NCBI-GeneID: 380732
NCBI-ProteinID: NP_001028607
MGI: 2685731
Ensembl: ENSMUSG00000040528
Vega: OTTMUSG00000003586
UniProt: Q3TB92
Position
11; 11 E1
AA seq 246 aa
MGDGDSPMCLSAVSFKGIRCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSM
NVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKC
KVNVSNLMKYSQDFNFTMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKK
TQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYI
YSELTH
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggcgatggtgactcgccaatgtgcctctctgccgtttcattcaagggaataagatgc
tggctggacaaactgttactttgggctcttacaatttctatcacacttcagaatgctgca
gtggattgtacgagggtggaaaataacgaattaccttctccaaatctgaactcaagtatg
aacgtggtcaggatgggccaaaatgtatctctgtcttgttccaccaagaacacatcagta
gacatcacctattcgctcttctggggtacaaaatatctagaaagcaagagaagacgaggg
ggagctgtggatttccacctgaggatctccaatgccaacgagtcaggcccctacaaatgc
aaagtcaatgtttccaacttgatgaaatacagtcaggatttcaacttcacaatggccaaa
gatgagagctgcccttcatgccggctgtcactgttgctcccagggctgttactggggata
ctggtaatagtcctagttctggcttatttgattcatctaaaatacaaaaaaggaaagaag
actcagagagaggaccagtccaagggttctggagatgcgcctgcacaggacgagctgtat
gtcaacgcctgcaagactcagacagagcaaccccaggagatacactatgccactccagtc
ttcaaggagatggcacccatggaagaagaaggtggtacggatggaaaagctgattacatc
tactctgaactcacccactga

DBGET integrated database retrieval system