KEGG   Mus musculus (mouse): 380752Help
Entry
380752            CDS       T01002                                 

Gene name
Eipr1, D12Ertd604e, Tssc1
Definition
(RefSeq) EARP complex and GARP complex interacting protein 1
  KO
K23289  EARP and GARP complex-interacting protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    380752 (Eipr1)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   Others
    380752 (Eipr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 380752
NCBI-ProteinID: NP_958745
MGI: 1289332
Ensembl: ENSMUSG00000036613
UniProt: Q8K0G5
Position
12 A2; 12 11.26 cM
AA seq 386 aa AA seqDB search
MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVL
LHQAGEIWHISASPADKGVLATCYNKTTDSRVQACAAVWRMPKELESGSHESPDDPASTA
QTLELLCHLDNSAQGNVACVVWEPMGDGKKVISLADSHILLWDLQPSSSQAVLASSATLE
GRGQLKFTAGRWSPHHNCTQVATASDTTLRGWDTRSMSQIYCIENAHGQLVRDLDFNPNK
QYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWSVRYNHSHDQLVLTGSSDSRVILS
NMVSISSEPFGHLVDDGDISDPEEHHAEKSKEPLQDNVIATYEEHEDSVYAVDWASADPW
LFASLSYDGRLVINRVPRALKYHILL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgacgccccggtgatttacgggctggaattccaggcacgtgctctaacacct
caaactgcggaaacagatgccattcgcttcttggttgggacgcagtctcttaaatatgat
aatcagatccacatcatagactttgatgacgaaaataacattataaataaaaatgtcctc
ctccatcaagcgggtgagatctggcacatcagtgccagcccggcagataaaggtgtgctg
gccacctgctacaacaaaactacagacagtcgagtccaggcgtgtgcagctgtgtggagg
atgcccaaggaattagaatccggtagccacgagtcccctgacgaccctgcaagcactgct
cagaccctggagctgctctgtcaccttgacaactcggcccaaggcaacgtggcctgtgtc
gtgtgggaaccgatgggggatgggaagaaggtcatttccctggccgatagccacatcctg
ctgtgggacctccagcccagctcgagccaggctgtgctggccagctcagcaacactggaa
ggaaggggacagctgaagttcaccgcggggcggtggagcccacaccacaactgtacccag
gtggccacagcaagtgacacgaccctccgaggatgggacacacggagcatgagccagata
tactgcatagagaacgctcatgggcagctggtgcgtgacctagacttcaaccccaacaag
cagtattacctcgccagctgtggagatgactgcaaggtgaagttctgggacacacggaat
gtcaccgagcctgtgaagaccctggaggagcactcccactgggtgtggagtgtgcgctac
aaccactctcacgaccagctggtcctcactggcagcagcgacagcagagtcatcctgtcc
aacatggtatctatctcctcagagccctttggtcacctggtggacgacggtgacatcagt
gatccagaagagcaccatgctgaaaagagcaaggaacccctgcaggacaacgttattgcc
acctatgaggagcatgaggacagcgtgtatgcagtggactgggcctcagctgacccatgg
ctgtttgcttccctaagttacgacgggagactggttatcaacagagttcccagggcactg
aagtaccacatactgctctag

DBGET integrated database retrieval system