KEGG   Mus musculus (mouse): 380768
Entry
380768            CDS       T01002                                 

Symbol
Ccdc177, Gm1568
Name
(RefSeq) coiled-coil domain containing 177
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4659
Other DBs
NCBI-GeneID: 380768
NCBI-ProteinID: NP_001008423
MGI: 2686414
Ensembl: ENSMUSG00000062961
UniProt: Q3UHB8
Position
12:complement(80802221..80807489)
AA seq 706 aa
MVDPVPEEEKEGAEPGGSEGDEATASEPPDAQGAQQPAASSASASAAAPRKAEVPCGAEG
GRREQSPLLHLDLFNFACPEAEGSRYVLTSPRSLEACARCAVKPVELLPRALADLVREAP
GRSMRVATGLYEAYEAERLAKLQQCRAERERIMREEKRRLFTPKGPAAAPASASASASAS
ALSGGSSSSCSSSSSLPASPASRVARRTSPSPPARSRPPPAGSRTGRKSHSLDSLSRRRD
GALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSASSAPNPLGRPSALALVPLTAR
SFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVPERDRKIAALMLARHQEERLLLEQRAA
AHGQWEQQRVRAEQRREREEREKQRALERGRRAWAAQVEERRGRRGREEREAARRRQQQC
ERSEERRRELAERQGLLRRERVERAARDDRLRKLQQEQNLKQREEGRQEGRERAELVRRE
RAQRAARARERQEGQLQREKRELSRAERARHEALLRGRVRQQQEEREGLRSSLEASLGRA
QENYEQLQEQRARELRERARREELQGRRAKEAAERKEREHQAHLEALARAGERRLQHAAQ
VAEEAVQQKARRVVQTRLEKERAQRANKEKVERDEDCRRRELLQAIGRKLERSEQLSRER
RSALESARSTARASFHVREKVREETNTRSFDRMVREAQLHASLDRK
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggtggacccggtgccagaagaggagaaagagggagcggagcccggtggctctgaaggg
gatgaggccacagcgtccgagccccccgatgcccagggagcccagcagccggctgcctcc
tcggcctccgcctccgcggcggcgccccgtaaggctgaagtcccctgcggggcagaaggt
ggacgtcgggagcagtctccgttgctgcacctcgatctcttcaatttcgcctgccccgag
gcagagggcagccgctacgtcctgaccagcccccgctctctggaggcctgcgcccgatgc
gcggtcaagcccgtggagctgctgcctcgggccctggccgacctggtgcgcgaggccccg
ggccgctccatgcgcgtggccaccggcctgtacgaggcctacgaggcggagcgcctggcc
aaactgcagcagtgccgcgccgagcgcgagcgcatcatgcgcgaggagaagcggcgcctg
ttcacaccgaagggtccggcggcagccccggcctcggcctcagcctcagcctcagcctcg
gccctgagcgggggcagcagcagcagctgcagcagcagcagcagcctcccggcctcgccc
gcctcgcgagttgctcgaaggacttctcccagtccccccgccaggagccggcctccgccc
gccggttctcggacaggtagaaagagccactcgctggactcgctctcccgccggagggac
ggtgccctgagctccgagtccggggcctcgtcgtcgtcctacagcggggagagccttcgg
gagcttcgctggccacctcgagcttccgccaggaacagctgccccgcgggctcggcgtcg
tctgcacctaacccactgggccgcccttcggcccttgctctggttccgctcacggcccgc
agcttcagcctcggagacctgagccactcgccgcagacagcccagcatgtggagcgcatc
gtccgccaagtgcgcgccgagcgaggcctgcgcggggtacccgagcgcgaccgcaagatc
gccgccctcatgctggcccggcaccaggaagagcgcctgttgctggagcagcgcgccgcg
gcccacggccagtgggagcagcagcgcgtgcgcgccgaacagcggcgggagcgcgaggag
cgagagaagcagcgcgcgctggagcggggccggcgggcctgggcggcgcaggtggaggag
cggcgcggtcgccggggccgggaggagcgcgaggccgcgcggaggcggcagcagcagtgc
gagcgcagcgaggagcggcggcgggagctggcggagcgtcagggactgctgcggcgggag
cgggtggaacgcgccgcgcgggacgaccggctgcgcaagctgcagcaggagcagaacctg
aagcagagggaggagggccggcaagaggggcgggagcgcgcggagctggtccgccgggag
cgcgcccagcgggcggcgcgcgcccgagagcggcaagagggccaactgcagcgcgagaag
cgcgagctgagccgggccgagcgggcgcgccacgaggcgctgcttagaggccgagtccgg
cagcagcaggaggagcgggagggcctgcggagctccctggaggccagcttgggccgcgcg
caagagaactacgagcagctgcaggaacagcgcgcccgggagctgcgggagcgcgcgcgg
agagaggagctccagggtcggcgggcgaaggaagcggccgagcgcaaagagcgggagcat
caggcgcacttggaggcgctggcgcgggcgggagaacgacggctgcagcacgcggcgcag
gtggccgaagaggctgtgcagcagaaggcccggcgcgtggttcagacccgcctggaaaag
gagagggcccagcgtgccaacaaggagaaggtagagagagacgaagactgccgccgccgc
gagctgctgcaggccattgggcgcaagctggagcgcagtgagcagctctctcgagaacgg
cgaagcgcgctggagagcgctcgctccacggcccgggcctccttccatgtgcgggagaag
gtgcgggaggagaccaacacgcgctcttttgaccgcatggtgcgagaggcccagctacat
gccagcctggaccgcaaatga

DBGET integrated database retrieval system