KEGG   Mus musculus (house mouse): 380921
Entry
380921            CDS       T01002                                 
Symbol
Dgkh, 5930402B05Rik, D130015C16, DGK
Name
(RefSeq) diacylglycerol kinase, eta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    380921 (Dgkh)
   00564 Glycerophospholipid metabolism
    380921 (Dgkh)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    380921 (Dgkh)
   04072 Phospholipase D signaling pathway
    380921 (Dgkh)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    380921 (Dgkh)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     380921 (Dgkh)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 PH PH_8 C1_2 Mcp5_PH PH_11
Other DBs
NCBI-GeneID: 380921
NCBI-ProteinID: NP_001074805
MGI: 2444188
Ensembl: ENSMUSG00000034731
UniProt: D3YXJ0
Position
14:complement(78796789..78970169)
AA seq 1180 aa
MEPQHVRPVLGAQSPAWEEPESERMAGAGSQHHPQGVAGGAVAGASAVSPTAAGPGEDSS
DSEAEQEGPQKLIRKVSTSGQMRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKD
SKSLIFDEVDLSDASVAEASTKNANNSFTIITPFRRLMLCAENRKEMEVWISSLKSVQSR
EPYEVAQFNVEHFSGMHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAV
RATNNCKWTTLASIGKDIIEDEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKC
LWCKTMVHTACKDVYHPVCPLGQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNS
KSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPYLGLRLFQKFDNFRILVCGGDGSVGWVLS
EIDKLNLHKQCQLGVLPLGTGNDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSI
MTYELKLPAKSSLLPEPVAATEEFYMTIYEDSVANHLTKIVNSDEHAVVISSAKILCETV
KDFVAKVEKAQDRTLENTVVAEAVASKCSVLNEKLEQLLQALHADSQASRVPPGIGPAIP
EEDTVESASDESLGESKDQLVNDIGKPSSQKAVKPREIMLRANSLKKAVRQVIEEAEKVM
DEPAVQPSEPVSPSCDYDTETDEAKEDDAKESLSAKTTSQSPDAQASCGHPQTDSVAGPA
MATTKENLPVLNTRIICPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSLDG
YSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNL
EQRVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAV
FDSVQMAVSRVIKLQHHRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQ
MLTRDRAFESTLKSWEDKQKCDSGKPVLRTNLYIHPAPDLATEEVSQMRLCSQAAEELIT
RICDAATIHCLLEQELAHAVNACSHALNKANPRFPESLTRDTATEIAINVKALYNETEAL
LVGRVPLHLESPHEERVSSALHSVEMELQKLTEIPWLYYILRPSEDEEPPLDCTKRNNKS
TVFRIVPKFKKEKAQKQKTSSQPGPGDSESGSYEANSPGN
NT seq 3543 nt   +upstreamnt  +downstreamnt
atggagcctcagcacgtgcgccccgtgcttggagcccagagcccggcctgggaggaaccg
gaatcagagaggatggccggggccggcagccagcaccaccctcagggcgtcgcgggagga
gcggtcgctggggccagcgcggtttcccccactgctgcaggaccgggagaggattcgtcc
gacagtgaagcggagcaggaggggccccagaagctgatccgtaaagtgtccacctctgga
cagatgcggaccaagactagtattaaggaaggacaactgctgaagcaaaccagctctttc
caaaggtggaagaagagatacttcaagcttcgcggccgcacactttattatgcgaaagac
tccaagtccttgatatttgatgaagttgacctctcagatgccagtgttgcggaagcaagc
acaaaaaatgccaacaacagctttacgatcatcactccgttcagaagactgatgctatgt
gctgagaacaggaaagagatggaggtctggatcagctctctgaagtcagtgcagagcaga
gaaccctatgaggtggcccagttcaatgtggaacatttctcagggatgcacaactggtac
gcctgctcccacgcccggcccaccttctgtaacgtgtgcagagagagtctctctggagtg
acctcccacggcctgtcctgtgaagtgtgtaagttcaaggctcataaaagatgtgcagtg
agggcaacaaacaactgcaaatggaccacgctggcctccatcgggaaggacatcatagag
gacgaggatggtgttgccatgcctcaccagtggctcgaaggcaacttgcctgtgagtgcc
aagtgtgcagtctgtgacaaaacctgtggcagtgtgcttcgcctgcaagattggaaatgc
ctttggtgtaagacaatggtgcacactgcctgcaaagatgtgtaccatcccgtctgtccc
cttggccagtgtaaagtctccatcatacctccgattgcactaaatagcacagactctgat
ggtttctgtcgagcaaccttttcgttctgtgtcagccccctcttggtgttcgtcaactct
aagagtggagataatcagggagtgaagttccttcgtcgctttaaacagttgctcaaccca
gctcaggtgtttgatttaatgaacggagggccttatttaggcttgagattgtttcaaaag
tttgacaactttcggatccttgtctgtggaggagatggaagtgtaggctgggttttgtca
gagattgataaactgaacttgcataaacagtgccagcttggggtgctacccttgggtacc
ggcaatgaccttgctcgagttcttggctggggaggttcatatgatgatgacacccaactc
cctcagatactagagaagctggaacgagccagtaccaaaatgctggacaggtggagtata
atgacctatgagctcaaattgccagcaaagtcgtctctacttcctgaacctgtggcagca
actgaagaattttacatgacaatttatgaagactccgttgcaaaccatcttacgaaaatc
gtcaactctgatgagcatgcggtggtcatatcgtctgccaagatactctgtgaaaccgtg
aaggacttcgttgccaaagtggagaaggcacaggacagaacactggaaaatacagtagta
gccgaagccgtggccagtaaatgctcagtcctaaacgagaagcttgagcagttgctacaa
gccttgcacgcggactctcaggccagtcgagtccccccaggaatcggccctgccatcccc
gaagaggacaccgtggagtccgccagtgacgagtccttgggtgaaagcaaggaccagctg
gtgaatgacattgggaaaccctcctcccagaaagccgtgaagccccgggagataatgctg
cgggccaacagtctaaagaaagcggtgaggcaagtcattgaagaagctgaaaaagttatg
gatgagccagcagtgcagccctctgagccagtcagtccgtcttgtgactatgatacagaa
acagatgaagctaaagaggacgacgcgaaagagtcgctatcagccaaaaccacatctcag
tctcctgatgcccaggcaagctgtggccatccccaaactgactctgtcgctggtccagcc
atggccaccaccaaagaaaacctccctgtgctcaacactagaatcatctgcccaggtttg
agagcaggacttgctgcctccattgctgggagttctatcatcaacaaaatgttgctggcg
aacatcgatcctttcggggcaacaccgtttattgacccagatctagactcactagatgga
tactctgaaaaatgtgtcatgaacaactactttgggattggattagatgcaaaaatttca
ttagaatttaataataagagagaggagcaccctgaaaaatgcagaagtcgaactaaaaac
ttgatgtggtacggagtccttgggacccgggagctactacagagatcgtacaagaatctg
gagcagagggttcaacttgagtgtgatgggcagtatatacctcttcctagtctacaaggc
atagcggtgttgaacatccctagctacgccggaggcaccaacttctggggcggaaccaaa
gaggatgatatatttgctgcgccatcctttgatgacaagattctagaagttgtcgcagtg
tttgacagtgtgcagatggcagtatcaagggtcattaaattgcagcatcaccggatagca
cagtgccgtacggtaaaaatcacgatatttggcgacgagggagtcccagtgcaggtggat
ggtgaagcatgggtccagcctccagggatcatcaagattgtgcacaaaaacagagctcag
atgctaaccagagacagagcctttgaaagcaccctgaagtcttgggaagacaagcagaag
tgtgactctgggaagccagttcttcgaaccaacctgtacatccatcccgcccctgacctg
gcaacagaggaagtgtcacagatgcggctctgctcccaggctgcggaggaactcatcact
aggatttgtgacgcagccacgattcactgtctcctggagcaggagctggcacatgcagtg
aatgcctgctcacacgccctgaacaaagccaacccacgcttcccggagagccttacgaga
gacactgccaccgagatagccatcaacgtcaaggcgctctataatgagacagaggctttg
ctagttggcagggtccctttgcacttggaatctcctcacgaagagcgggtgtccagtgcc
ttacactctgtggagatggagcttcagaagttaacggagattccctggctttattacatc
ctccgccccagtgaggacgaggagcctcctctggattgtaccaaaagaaacaacaaaagc
acagtctttcgcatagtgccaaagtttaaaaaggaaaaggctcagaaacagaaaacaagt
tcgcagcctggacctggggattccgaaagtgggtcatatgaagcgaattctccagggaat
taa

DBGET integrated database retrieval system