KEGG   Mus musculus (mouse): 380959Help
Entry
380959            CDS       T01002                                 

Gene name
Alg10b, AA469671, AU045404, AW123895, C85569, Deaf1, Gm917, nse5
Definition
(RefSeq) asparagine-linked glycosylation 10B (alpha-1,2-glucosyltransferase)
  KO
K03850  alpha-1,2-glucosyltransferase [EC:2.4.1.256]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    380959 (Alg10b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    380959 (Alg10b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.256  dolichyl-P-Glc:Glc2Man9GlcNAc2-PP-dolichol alpha-1,2-glucosyltransferase
     380959 (Alg10b)
Glycosyltransferases [BR:mmu01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   380959 (Alg10b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIE2_ALG10
Motif
Other DBs
NCBI-GeneID: 380959
NCBI-ProteinID: NP_001028613
MGI: 2146159
Ensembl: ENSMUSG00000075470
UniProt: Q3UGP8
Position
15; 15 E3
AA seq 474 aa AA seqDB search
MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGRFSLSQWDP
MITTLPGLYLVSVGVVKPASWLLGWSEHVICSIGVLRFVNLLFSVGNFYLLYLLFRKVQP
RNKASSSIQRILSTLTLAVFPTLYFFNFLYYTEAGSVFFTLFAYLMCLYGNHRTSALLGF
CGFMFRQTNIIWAAFCAGHLIAQKCSEAWKIELQKKKEERLAPTKGPLSELRRVLQFLLV
YAMSLKNLRMLFLLTWPYVLLLLAFFAFVVVNGGIVVGDRSSHEACLHFPQLFYFFSFTA
FFSFPHLLSLTKVKTFLSLVWKRRVQFSVVTLVSILLVWKFTYVHKYLLADNRHYTFYVW
KRVFQRHEVVKYLLVPAYIFAGWAIADSLKAKSIFWNLMFFVCLVASTVPQKLLEFRYFI
LPYIIYRLNIPLPPISRLVCELGCYTVVNFVTFYIFLNKTFQWPNSQDIQRFMW
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctggagggctattacttctcggccgccttgagctgcaccttcctggtgtcc
tgcctgctcttctccgccttcagccgcgctctgcgggagccgtacatggacgagatcttc
cacctgccgcaggcgcagcggtactgcgagggccgcttctccctgtcgcagtgggatcct
atgatcactacattacctggcctgtatctggtgtcggtcggtgtggtcaaacctgccagc
tggctccttggatggtctgagcatgtgatctgctccattggggtgctcagatttgtcaat
cttctcttcagcgttggcaacttctacttgctgtatttgctcttcaggaaggtgcaaccc
agaaacaaggcttcttcaagtatccagagaatcttgtcaacattaaccctagcagtgttt
ccaaccctctatttttttaacttcctttactatacagaagctgggtctgtattcttcact
ctttttgcttatttgatgtgtctttatggcaaccataggacctcggccttgcttggattt
tgtggtttcatgtttcgtcagaccaacatcatctgggcggccttctgtgcaggacacctc
attgcacagaagtgcagtgaagcctggaagattgagctgcagaagaagaaggaggagagg
cttgcgcccacgaagggaccgctctcggagctcagaagagtgctgcagtttctgctggtg
tacgccatgtccctaaagaacctgagaatgctcttcctgttgacctggccctacgtgctt
ctgctgttggcgttctttgcctttgtggtagttaatggtggcattgttgttggtgaccgg
agtagtcacgaggcctgtctccattttcctcagttgttctatttcttctcctttactgcc
tttttctccttccctcacctactttctctgaccaaagtcaagactttccttagcttagtt
tggaagcgtagagtccagttctctgtggttacgttagtctcgatacttttggtttggaaa
ttcacttatgtccataagtatttactggcagacaataggcattacacattttatgtgtgg
aaaagagtatttcagagacatgaagttgtcaaatatttattagttccagcctacattttt
gctggttgggctatagctgactctttaaaggctaagtcaattttctggaatttaatgttt
tttgtatgcttggttgcttctacagttcctcagaaactactagaattccgttacttcatt
ctaccatacattatttataggcttaacatacctctgccacccatatctagactcgtttgt
gaactgggttgctatacagttgttaattttgtaactttttatatctttctgaacaagact
tttcagtggccaaatagtcaggacatccaaaggtttatgtggtag

DBGET integrated database retrieval system